BLASTX nr result
ID: Cornus23_contig00030205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00030205 (435 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CEJ54059.1| Putative Serine/threonine-protein phosphatase [P... 67 5e-09 gb|KIW47640.1| serine/threonine-protein phosphatase PP1, variant... 67 5e-09 gb|KIW02659.1| serine/threonine-protein phosphatase PP1 [Verruco... 67 5e-09 ref|XP_009348143.1| PREDICTED: serine/threonine-protein phosphat... 67 5e-09 gb|KFY87845.1| hypothetical protein V498_07008 [Pseudogymnoascus... 67 5e-09 gb|KFY73390.1| hypothetical protein V499_06526 [Pseudogymnoascus... 67 5e-09 gb|KFX93858.1| hypothetical protein V490_04627 [Pseudogymnoascus... 67 5e-09 ref|XP_013431336.1| pp1, catalytic subunit of type 1 serine/thre... 67 5e-09 gb|EEH11297.1| serine/threonine phosphatase PP1 [Histoplasma cap... 67 5e-09 gb|EZG07706.1| serine/threonine-protein phosphatase PP1 [Trichop... 67 5e-09 gb|EZF24267.1| serine/threonine-protein phosphatase PP1 [Trichop... 67 5e-09 gb|EQL29747.1| serine/threonine-protein phosphatase PP1, variant... 67 5e-09 ref|XP_009154438.1| serine/threonine-protein phosphatase PP1, va... 67 5e-09 ref|XP_003857455.1| pp1, catalytic subunit of type 1 serine/thre... 67 5e-09 ref|XP_003189574.1| serine/threonine-protein phosphatase PP2A ca... 67 5e-09 ref|XP_001546112.1| serine / threonine protein phosphatase type ... 67 5e-09 ref|XP_002150195.1| serine/threonine protein phosphatase PP1, pu... 66 1e-08 ref|XP_003838407.1| hypothetical protein LEMA_P113430.1 [Leptosp... 54 9e-08 ref|XP_956154.2| serine/threonine-protein phosphatase PP1 [Neuro... 59 1e-06 ref|XP_013317179.1| serine/threonine-protein phosphatase PP1, va... 59 1e-06 >emb|CEJ54059.1| Putative Serine/threonine-protein phosphatase [Penicillium brasilianum] Length = 308 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 277 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 308 >gb|KIW47640.1| serine/threonine-protein phosphatase PP1, variant [Exophiala oligosperma] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >gb|KIW02659.1| serine/threonine-protein phosphatase PP1 [Verruconis gallopava] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >ref|XP_009348143.1| PREDICTED: serine/threonine-protein phosphatase PP1 isoform X2 [Pyrus x bretschneideri] Length = 308 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 277 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 308 >gb|KFY87845.1| hypothetical protein V498_07008 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 475 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 444 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 475 >gb|KFY73390.1| hypothetical protein V499_06526 [Pseudogymnoascus pannorum VKM F-103] Length = 454 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 423 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 454 >gb|KFX93858.1| hypothetical protein V490_04627 [Pseudogymnoascus pannorum VKM F-3557] gi|682275775|gb|KFX98336.1| hypothetical protein O988_04394 [Pseudogymnoascus pannorum VKM F-3808] gi|682286291|gb|KFY05857.1| hypothetical protein V492_08262 [Pseudogymnoascus pannorum VKM F-4246] gi|682323565|gb|KFY25760.1| hypothetical protein V491_01604 [Pseudogymnoascus pannorum VKM F-3775] gi|682325980|gb|KFY27171.1| hypothetical protein V493_03672 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] gi|682347765|gb|KFY40423.1| hypothetical protein V494_03510 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] gi|682364118|gb|KFY51078.1| hypothetical protein V496_08959 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682373933|gb|KFY58726.1| hypothetical protein V497_04702 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] gi|682436497|gb|KFZ01100.1| hypothetical protein V501_10217 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >ref|XP_013431336.1| pp1, catalytic subunit of type 1 serine/threonine protein phosphatase [Aureobasidium namibiae CBS 147.97] gi|662504638|gb|KEQ62254.1| pp1, catalytic subunit of type 1 serine/threonine protein phosphatase [Aureobasidium melanogenum CBS 110374] gi|662519071|gb|KEQ76630.1| pp1, catalytic subunit of type 1 serine/threonine protein phosphatase [Aureobasidium namibiae CBS 147.97] gi|662528640|gb|KEQ86017.1| pp1, catalytic subunit of type 1 serine/threonine protein phosphatase [Aureobasidium pullulans EXF-150] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >gb|EEH11297.1| serine/threonine phosphatase PP1 [Histoplasma capsulatum G186AR] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >gb|EZG07706.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum CBS 735.88] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >gb|EZF24267.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum MR850] gi|607906083|gb|EZF43352.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum CBS 100081] gi|607918259|gb|EZF54073.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum CBS 288.86] gi|607930225|gb|EZF64600.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum CBS 289.86] gi|607942169|gb|EZF75256.1| serine/threonine-protein phosphatase PP1 [Trichophyton soudanense CBS 452.61] gi|607954330|gb|EZF85978.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum MR1448] gi|607966490|gb|EZF96708.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum MR1459] gi|607990376|gb|EZG18189.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum CBS 202.88] gi|633060452|gb|KDB35061.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum D6] gi|674808307|gb|KFL62056.1| serine/threonine-protein phosphatase PP1 [Trichophyton rubrum CBS 118892] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >gb|EQL29747.1| serine/threonine-protein phosphatase PP1, variant 1 [Blastomyces dermatitidis ATCC 26199] gi|893697726|gb|KMW68069.1| serine/threonine-protein phosphatase PP1, variant [Blastomyces dermatitidis ATCC 18188] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >ref|XP_009154438.1| serine/threonine-protein phosphatase PP1, variant 1 [Exophiala dermatitidis NIH/UT8656] gi|378727517|gb|EHY53976.1| serine/threonine-protein phosphatase PP1, variant 1 [Exophiala dermatitidis NIH/UT8656] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >ref|XP_003857455.1| pp1, catalytic subunit of type 1 serine/threonine protein phosphatase [Zymoseptoria tritici IPO323] gi|631371348|ref|XP_007920054.1| hypothetical protein MYCFIDRAFT_48805 [Pseudocercospora fijiensis CIRAD86] gi|339477340|gb|EGP92431.1| pp1, catalytic subunit of type 1 serine/threonine protein phosphatase [Zymoseptoria tritici IPO323] gi|452848112|gb|EME50044.1| hypothetical protein DOTSEDRAFT_68784 [Dothistroma septosporum NZE10] gi|452989397|gb|EME89152.1| hypothetical protein MYCFIDRAFT_48805 [Pseudocercospora fijiensis CIRAD86] gi|453088799|gb|EMF16839.1| serine/threonine phosphatase PP1 [Sphaerulina musiva SO2202] gi|796706352|gb|KJX97790.1| serine/threonine-protein phosphatase PP1 [Zymoseptoria brevis] Length = 309 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 309 >ref|XP_003189574.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Aspergillus oryzae RIB40] Length = 308 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 277 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 308 >ref|XP_001546112.1| serine / threonine protein phosphatase type 1 [Botrytis cinerea B05.10] Length = 308 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR Sbjct: 277 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 308 >ref|XP_002150195.1| serine/threonine protein phosphatase PP1, putative [Talaromyces marneffei ATCC 18224] gi|242802911|ref|XP_002484069.1| serine/threonine protein phosphatase PP1, putative [Talaromyces stipitatus ATCC 10500] gi|210067494|gb|EEA21586.1| serine/threonine protein phosphatase PP1, putative [Talaromyces marneffei ATCC 18224] gi|218717414|gb|EED16835.1| serine/threonine protein phosphatase PP1, putative [Talaromyces stipitatus ATCC 10500] Length = 308 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQNRFGR+ Sbjct: 277 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRK 308 >ref|XP_003838407.1| hypothetical protein LEMA_P113430.1 [Leptosphaeria maculans JN3] gi|312214975|emb|CBX94928.1| hypothetical protein LEMA_P113430.1 [Leptosphaeria maculans JN3] Length = 430 Score = 54.3 bits (129), Expect(3) = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQ 356 NAGAMMSVDESLLCSFQILKPAEKKQ Sbjct: 301 NAGAMMSVDESLLCSFQILKPAEKKQ 326 Score = 25.0 bits (53), Expect(3) = 9e-08 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 351 DLGVVRR*HIAKPSTS 304 DLG VRR H+AK S S Sbjct: 358 DLGAVRRWHVAKQSAS 373 Score = 22.7 bits (47), Expect(3) = 9e-08 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 260 NIVFHPSTTRTSFDMCT 210 ++V H TT+ FD+CT Sbjct: 383 DLVHHRPTTQIPFDICT 399 >ref|XP_956154.2| serine/threonine-protein phosphatase PP1 [Neurospora crassa OR74A] gi|698987698|ref|XP_009850830.1| Serine/threonine-protein phosphatase PP1 [Neurospora tetrasperma FGSC 2508] gi|14285668|sp|Q9UW86.1|PP1_NEUCR RecName: Full=Serine/threonine-protein phosphatase PP1; AltName: Full=Phosphoprotein phosphatase 1 gi|5712617|gb|AAD47567.1|AF124149_1 protein phosphatase-1 [Neurospora crassa] gi|157072277|gb|EAA26918.2| serine/threonine-protein phosphatase PP1 [Neurospora crassa OR74A] gi|336469571|gb|EGO57733.1| Serine/threonine-protein phosphatase PP1 [Neurospora tetrasperma FGSC 2508] gi|350290781|gb|EGZ71995.1| Serine/threonine-protein phosphatase PP1 [Neurospora tetrasperma FGSC 2509] gi|725974589|gb|KHE78351.1| hypothetical protein GE21DRAFT_4317 [Neurospora crassa] Length = 308 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQ +FGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQ-KFGRR 308 >ref|XP_013317179.1| serine/threonine-protein phosphatase PP1, variant [Exophiala xenobiotica] gi|759280091|gb|KIW56595.1| serine/threonine-protein phosphatase PP1, variant [Exophiala xenobiotica] Length = 308 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 433 NAGAMMSVDESLLCSFQILKPAEKKQNRFGRR 338 NAGAMMSVDESLLCSFQILKPAEKKQ +FGRR Sbjct: 278 NAGAMMSVDESLLCSFQILKPAEKKQ-KFGRR 308