BLASTX nr result
ID: Cornus23_contig00029860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029860 (597 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO54297.1| hypothetical protein CISIN_1g042261mg [Citrus sin... 59 4e-08 >gb|KDO54297.1| hypothetical protein CISIN_1g042261mg [Citrus sinensis] Length = 172 Score = 58.5 bits (140), Expect(2) = 4e-08 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = +2 Query: 20 FSTRHLSSFRFPLHPLFHMVLYHLNVCPLQVNPNFFRTISILLSLNRSRKLDLGM 184 FS +H S+ RFPLHPL H Y LN+ P+QV+PN R +S L LN + DL + Sbjct: 48 FSCKHFSAIRFPLHPLIHNFFYRLNLTPVQVHPNSLRILSSALVLNIIKGWDLNL 102 Score = 26.2 bits (56), Expect(2) = 4e-08 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 184 DLLYCYKVTKNRDDGRRFALFPRKNRSIYTCKPTSD 291 D+ CYKV+ +D+ F L R+I PTS+ Sbjct: 104 DIFNCYKVSAIKDEHGFFHLASLHKRAIVCGNPTSE 139