BLASTX nr result
ID: Cornus23_contig00029663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029663 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347367.1| PREDICTED: mitochondrial import inner membra... 59 2e-06 ref|XP_004241472.1| PREDICTED: mitochondrial import inner membra... 59 2e-06 gb|ACG48721.1| hypothetical protein [Zea mays] 58 2e-06 ref|NP_001146964.1| mitochondrial import inner membrane transloc... 58 2e-06 ref|XP_009797013.1| PREDICTED: mitochondrial import inner membra... 57 4e-06 ref|XP_009797012.1| PREDICTED: mitochondrial import inner membra... 57 4e-06 ref|XP_004968261.1| PREDICTED: mitochondrial import inner membra... 57 5e-06 ref|XP_010942607.1| PREDICTED: mitochondrial import inner membra... 57 7e-06 ref|NP_001042072.1| Os01g0157800 [Oryza sativa Japonica Group] g... 56 9e-06 ref|XP_011624522.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_012460823.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 gb|KHG13401.1| Mitochondrial import inner membrane translocase s... 56 9e-06 ref|XP_010253548.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_009378117.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_009378116.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_009378115.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_008354066.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_008354065.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_008376312.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 ref|XP_008233364.1| PREDICTED: mitochondrial import inner membra... 56 9e-06 >ref|XP_006347367.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Solanum tuberosum] Length = 109 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDV+ G+TKGANS F Sbjct: 79 PDAGGSHYLASKINEAKDVLLGKTKGANSAF 109 >ref|XP_004241472.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Solanum lycopersicum] Length = 109 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDV+ G+TKGANS F Sbjct: 79 PDAGGSHYLASKINEAKDVLLGKTKGANSAF 109 >gb|ACG48721.1| hypothetical protein [Zea mays] Length = 36 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVMTG+TKG S F Sbjct: 6 PDAGGSHYLASKINEAKDVMTGKTKGGGSAF 36 >ref|NP_001146964.1| mitochondrial import inner membrane translocase subunit TIM14 precursor [Zea mays] gi|670442969|ref|XP_008661862.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14 isoform X1 [Zea mays] gi|670442971|ref|XP_008661863.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14 isoform X1 [Zea mays] gi|670442973|ref|XP_008661864.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14 isoform X2 [Zea mays] gi|670442975|ref|XP_008661865.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14 isoform X2 [Zea mays] gi|194698396|gb|ACF83282.1| unknown [Zea mays] gi|195604188|gb|ACG23924.1| mitochondrial import inner membrane translocase subunit TIM14 [Zea mays] gi|195605908|gb|ACG24784.1| mitochondrial import inner membrane translocase subunit TIM14 [Zea mays] gi|223973567|gb|ACN30971.1| unknown [Zea mays] gi|413916899|gb|AFW56831.1| hypothetical protein ZEAMMB73_102669 [Zea mays] gi|413916900|gb|AFW56832.1| hypothetical protein ZEAMMB73_102669 [Zea mays] Length = 112 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVMTG+TKG S F Sbjct: 82 PDAGGSHYLASKINEAKDVMTGKTKGGGSAF 112 >ref|XP_009797013.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X2 [Nicotiana sylvestris] Length = 109 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHY+ASKINEAKD++ G+TKGANS F Sbjct: 79 PDAGGSHYIASKINEAKDILLGKTKGANSAF 109 >ref|XP_009797012.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X1 [Nicotiana sylvestris] Length = 122 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHY+ASKINEAKD++ G+TKGANS F Sbjct: 92 PDAGGSHYIASKINEAKDILLGKTKGANSAF 122 >ref|XP_004968261.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Setaria italica] gi|944240179|gb|KQL04487.1| hypothetical protein SETIT_003402mg [Setaria italica] Length = 112 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDV+TG+TKG S F Sbjct: 82 PDAGGSHYLASKINEAKDVLTGKTKGGGSAF 112 >ref|XP_010942607.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Elaeis guineensis] Length = 112 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PDGGGSHYLASKINEAKD++ GR KG +SVF Sbjct: 82 PDGGGSHYLASKINEAKDMLIGRQKGGSSVF 112 >ref|NP_001042072.1| Os01g0157800 [Oryza sativa Japonica Group] gi|54290798|dbj|BAD61437.1| putative DNAJ domain-containing; methylation-controlled J protein [Oryza sativa Japonica Group] gi|113531603|dbj|BAF03986.1| Os01g0157800 [Oryza sativa Japonica Group] gi|215768382|dbj|BAH00611.1| unnamed protein product [Oryza sativa Japonica Group] gi|937894516|dbj|BAS70496.1| Os01g0157800 [Oryza sativa Japonica Group] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDV+ G+TKG SVF Sbjct: 82 PDAGGSHYLASKINEAKDVLLGKTKGGGSVF 112 >ref|XP_011624522.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Amborella trichopoda] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 82 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112 >ref|XP_012460823.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Gossypium raimondii] gi|763809638|gb|KJB76540.1| hypothetical protein B456_012G094000 [Gossypium raimondii] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 82 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112 >gb|KHG13401.1| Mitochondrial import inner membrane translocase subunit TIM14 [Gossypium arboreum] Length = 117 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 87 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 117 >ref|XP_010253548.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Nelumbo nucifera] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 82 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112 >ref|XP_009378117.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 isoform X3 [Pyrus x bretschneideri] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 82 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112 >ref|XP_009378116.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 isoform X2 [Pyrus x bretschneideri] Length = 124 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 94 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 124 >ref|XP_009378115.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 isoform X1 [Pyrus x bretschneideri] Length = 137 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 107 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 137 >ref|XP_008354066.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 isoform X2 [Malus domestica] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 82 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112 >ref|XP_008354065.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 isoform X1 [Malus domestica] Length = 124 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 94 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 124 >ref|XP_008376312.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Malus domestica] Length = 46 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 16 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 46 >ref|XP_008233364.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Prunus mume] Length = 112 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 387 PDGGGSHYLASKINEAKDVMTGRTKGANSVF 295 PD GGSHYLASKINEAKDVM G+TKG+ S F Sbjct: 82 PDAGGSHYLASKINEAKDVMLGKTKGSGSAF 112