BLASTX nr result
ID: Cornus23_contig00029593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029593 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007778256.1| fatty acid elongase 3 [Coniosporium apollini... 82 1e-13 gb|KEQ86404.1| elongation of fatty acids protein 3 [Aureobasidiu... 80 5e-13 ref|XP_013429105.1| elongation of fatty acids protein 3 [Aureoba... 80 5e-13 gb|ABL63519.2| putative fatty acid elongase protein [Aureobasidi... 80 5e-13 gb|KEQ59075.1| elongation of fatty acids protein 3 [Aureobasidiu... 80 8e-13 ref|XP_007691039.1| hypothetical protein COCMIDRAFT_103481 [Bipo... 79 1e-12 ref|XP_007708729.1| hypothetical protein COCCADRAFT_23380 [Bipol... 79 1e-12 ref|XP_014082000.1| hypothetical protein COCC4DRAFT_30695 [Bipol... 79 1e-12 ref|XP_007697000.1| hypothetical protein COCSADRAFT_188084 [Bipo... 79 1e-12 dbj|GAM83883.1| hypothetical protein ANO11243_018730 [fungal sp.... 79 1e-12 ref|XP_013346914.1| hypothetical protein AUEXF2481DRAFT_46051 [A... 79 1e-12 ref|XP_003845185.1| similar to elongation of fatty acids protein... 79 2e-12 gb|KNG46126.1| elongation of fatty acids protein 3 [Stemphylium ... 76 1e-11 ref|XP_007586276.1| putative fatty acid elongase protein [Neofus... 74 4e-11 ref|XP_003297426.1| hypothetical protein PTT_07837 [Pyrenophora ... 74 6e-11 ref|XP_001941223.1| elongation of fatty acids protein 3 [Pyrenop... 74 6e-11 ref|XP_008028577.1| hypothetical protein SETTUDRAFT_164449 [Seto... 73 7e-11 gb|EKG18909.1| GNS1/SUR4 membrane protein [Macrophomina phaseoli... 73 9e-11 gb|KKY28105.1| putative fatty acid elongase [Diplodia seriata] 71 4e-10 ref|XP_007927024.1| hypothetical protein MYCFIDRAFT_46549 [Pseud... 71 4e-10 >ref|XP_007778256.1| fatty acid elongase 3 [Coniosporium apollinis CBS 100218] gi|494825809|gb|EON62939.1| fatty acid elongase 3 [Coniosporium apollinis CBS 100218] Length = 337 Score = 82.4 bits (202), Expect = 1e-13 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M PS++ YGVPTLDRPFGL+LWPIFE AFE + GYKPQDFRFVP Sbjct: 1 MSKPSWIQYGVPTLDRPFGLQLWPIFEKAFESVKGYKPQDFRFVP 45 >gb|KEQ86404.1| elongation of fatty acids protein 3 [Aureobasidium pullulans EXF-150] Length = 343 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M P ++ YGVPTLDRPFGLELWPIFE AF I GYKPQDFRFVP Sbjct: 1 MSTPEWIRYGVPTLDRPFGLELWPIFEKAFTSIKGYKPQDFRFVP 45 >ref|XP_013429105.1| elongation of fatty acids protein 3 [Aureobasidium namibiae CBS 147.97] gi|662517485|gb|KEQ75047.1| elongation of fatty acids protein 3 [Aureobasidium namibiae CBS 147.97] Length = 343 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M P ++ YGVPTLDRPFGLELWPIFE AF I GYKPQDFRFVP Sbjct: 1 MSTPEWIRYGVPTLDRPFGLELWPIFEKAFTSIKGYKPQDFRFVP 45 >gb|ABL63519.2| putative fatty acid elongase protein [Aureobasidium pullulans] Length = 343 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M P ++ YGVPTLDRPFGLELWPIFE AF I GYKPQDFRFVP Sbjct: 1 MSTPEWIRYGVPTLDRPFGLELWPIFEKAFTSIKGYKPQDFRFVP 45 >gb|KEQ59075.1| elongation of fatty acids protein 3 [Aureobasidium melanogenum CBS 110374] Length = 343 Score = 79.7 bits (195), Expect = 8e-13 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M P ++ YGVPTLDRPFGLELWPIFE AF + GYKPQDFRFVP Sbjct: 1 MSTPEWIRYGVPTLDRPFGLELWPIFEKAFTSLKGYKPQDFRFVP 45 >ref|XP_007691039.1| hypothetical protein COCMIDRAFT_103481 [Bipolaris oryzae ATCC 44560] gi|576928807|gb|EUC42436.1| hypothetical protein COCMIDRAFT_103481 [Bipolaris oryzae ATCC 44560] Length = 345 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRF 8 MG P ++ YGVPTLDRPFGL LWPIFE FEPI GYKPQDFRF Sbjct: 1 MGNPDWLEYGVPTLDRPFGLALWPIFEKVFEPIAGYKPQDFRF 43 >ref|XP_007708729.1| hypothetical protein COCCADRAFT_23380 [Bipolaris zeicola 26-R-13] gi|953435257|ref|XP_014559700.1| hypothetical protein COCVIDRAFT_13343 [Bipolaris victoriae FI3] gi|576922821|gb|EUC36945.1| hypothetical protein COCCADRAFT_23380 [Bipolaris zeicola 26-R-13] gi|578492759|gb|EUN30156.1| hypothetical protein COCVIDRAFT_13343 [Bipolaris victoriae FI3] Length = 345 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRF 8 MG P ++ YGVPTLDRPFGL LWPIFE FEPI GYKPQDFRF Sbjct: 1 MGNPEWLEYGVPTLDRPFGLALWPIFEKVFEPIAGYKPQDFRF 43 >ref|XP_014082000.1| hypothetical protein COCC4DRAFT_30695 [Bipolaris maydis ATCC 48331] gi|451999938|gb|EMD92400.1| hypothetical protein COCHEDRAFT_1021196 [Bipolaris maydis C5] gi|477591018|gb|ENI08091.1| hypothetical protein COCC4DRAFT_30695 [Bipolaris maydis ATCC 48331] Length = 345 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRF 8 MG P ++ YGVPTLDRPFGL LWPIFE FEPI GYKPQDFRF Sbjct: 1 MGNPEWLEYGVPTLDRPFGLALWPIFEKVFEPIAGYKPQDFRF 43 >ref|XP_007697000.1| hypothetical protein COCSADRAFT_188084 [Bipolaris sorokiniana ND90Pr] gi|451854021|gb|EMD67314.1| hypothetical protein COCSADRAFT_188084 [Bipolaris sorokiniana ND90Pr] Length = 345 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRF 8 MG P ++ YGVPTLDRPFGL LWPIFE FEPI GYKPQDFRF Sbjct: 1 MGNPDWLEYGVPTLDRPFGLALWPIFEKVFEPIAGYKPQDFRF 43 >dbj|GAM83883.1| hypothetical protein ANO11243_018730 [fungal sp. No.11243] Length = 346 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M LPS++ G PTLD PFGL+LWPIFE AFE I GYKPQDFRFVP Sbjct: 1 MSLPSWIKIGAPTLDHPFGLQLWPIFETAFEAIKGYKPQDFRFVP 45 >ref|XP_013346914.1| hypothetical protein AUEXF2481DRAFT_46051 [Aureobasidium subglaciale EXF-2481] gi|662541004|gb|KEQ98304.1| hypothetical protein AUEXF2481DRAFT_46051 [Aureobasidium subglaciale EXF-2481] Length = 343 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M P ++ YG PTLDRPFGLELWPIFE AF I GYKPQDFRFVP Sbjct: 1 MSTPEWIRYGAPTLDRPFGLELWPIFEKAFTSIKGYKPQDFRFVP 45 >ref|XP_003845185.1| similar to elongation of fatty acids protein [Leptosphaeria maculans JN3] gi|312221766|emb|CBY01706.1| similar to elongation of fatty acids protein [Leptosphaeria maculans JN3] Length = 349 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 121 FVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 +++YGVPTLDRPFGLELWPIFE FEPI GYKPQDFRFV Sbjct: 5 WIHYGVPTLDRPFGLELWPIFERVFEPIAGYKPQDFRFV 43 >gb|KNG46126.1| elongation of fatty acids protein 3 [Stemphylium lycopersici] Length = 349 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 MG P ++ G PTLDRPFGL LWPIFE FEPI GYKPQDFRFV Sbjct: 1 MGSPDWLEIGPPTLDRPFGLALWPIFEKCFEPIAGYKPQDFRFV 44 >ref|XP_007586276.1| putative fatty acid elongase protein [Neofusicoccum parvum UCRNP2] gi|485920156|gb|EOD46255.1| putative fatty acid elongase protein [Neofusicoccum parvum UCRNP2] Length = 344 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 M P ++ GVPTLDRPFG++LWPIFE AFE + GYKPQDFRFV Sbjct: 1 MSKPDWIQVGVPTLDRPFGVQLWPIFEKAFETVKGYKPQDFRFV 44 >ref|XP_003297426.1| hypothetical protein PTT_07837 [Pyrenophora teres f. teres 0-1] gi|311329877|gb|EFQ94473.1| hypothetical protein PTT_07837 [Pyrenophora teres f. teres 0-1] Length = 349 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 MG ++ G PTLDRPFGL LWPIFE FEPIVGYKPQDFRFV Sbjct: 1 MGGTDWLEIGPPTLDRPFGLALWPIFEKVFEPIVGYKPQDFRFV 44 >ref|XP_001941223.1| elongation of fatty acids protein 3 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977316|gb|EDU43942.1| elongation of fatty acids protein 3 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 349 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 MG ++ G PTLDRPFGL LWPIFE FEPIVGYKPQDFRFV Sbjct: 1 MGGTDWLEIGPPTLDRPFGLALWPIFEKVFEPIVGYKPQDFRFV 44 >ref|XP_008028577.1| hypothetical protein SETTUDRAFT_164449 [Setosphaeria turcica Et28A] gi|482807169|gb|EOA84221.1| hypothetical protein SETTUDRAFT_164449 [Setosphaeria turcica Et28A] Length = 349 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 MG P ++ G PTLDRPFG+ LWPIFE AFE I GYKPQDFRFV Sbjct: 1 MGNPDWLQAGAPTLDRPFGVALWPIFEKAFESIAGYKPQDFRFV 44 >gb|EKG18909.1| GNS1/SUR4 membrane protein [Macrophomina phaseolina MS6] Length = 346 Score = 72.8 bits (177), Expect = 9e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 M P ++ G PTLDRPFG++LWPIFE AFE + GYKPQDFRFV Sbjct: 1 MSKPDWIQIGAPTLDRPFGIQLWPIFEKAFETVKGYKPQDFRFV 44 >gb|KKY28105.1| putative fatty acid elongase [Diplodia seriata] Length = 348 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFV 5 M P ++ G PTLD PFGL LWPIFE AFE + GYKPQDFRFV Sbjct: 1 MSKPDWIQVGAPTLDHPFGLHLWPIFEKAFESVKGYKPQDFRFV 44 >ref|XP_007927024.1| hypothetical protein MYCFIDRAFT_46549 [Pseudocercospora fijiensis CIRAD86] gi|452982159|gb|EME81918.1| hypothetical protein MYCFIDRAFT_46549 [Pseudocercospora fijiensis CIRAD86] Length = 352 Score = 70.9 bits (172), Expect = 4e-10 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 136 MGLPSFVNYGVPTLDRPFGLELWPIFEAAFEPIVGYKPQDFRFVP 2 M P ++ G PTLDRPFG+ LWPIFE AFE + GY P+DFRFVP Sbjct: 1 MATPEWLQVGAPTLDRPFGVHLWPIFEKAFEAVKGYSPEDFRFVP 45