BLASTX nr result
ID: Cornus23_contig00029421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029421 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39109.1| hypothetical protein DOTSEDRAFT_75014 [Dothistrom... 57 7e-06 >gb|EME39109.1| hypothetical protein DOTSEDRAFT_75014 [Dothistroma septosporum NZE10] Length = 1259 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 RDYFDESLAPPPAFGGQAKIAEGGSPSRGTKFQEEL 195 RD+FDESLAPPPAF GQAK SPSRGTKFQE+L Sbjct: 1227 RDHFDESLAPPPAFAGQAK---SESPSRGTKFQEQL 1259