BLASTX nr result
ID: Cornus23_contig00029362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029362 (643 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001801785.1| hypothetical protein SNOG_11545 [Parastagono... 68 4e-09 >ref|XP_001801785.1| hypothetical protein SNOG_11545 [Parastagonospora nodorum SN15] gi|111060133|gb|EAT81253.1| hypothetical protein SNOG_11545 [Parastagonospora nodorum SN15] Length = 408 Score = 68.2 bits (165), Expect = 4e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -2 Query: 117 MSFQNYDQFQGQPTGDQPNQTGSQLDLGQQMDTSGNGFP 1 MSF YDQ QG P G+QPNQ+GSQ DLGQQMD SGNGFP Sbjct: 1 MSFSQYDQMQGPPAGEQPNQSGSQPDLGQQMDPSGNGFP 39