BLASTX nr result
ID: Cornus23_contig00029332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029332 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF11137.1| hypothetical protein SEPMUDRAFT_134346 [Sphaeruli... 70 5e-10 ref|XP_003855783.1| hypothetical protein MYCGRDRAFT_103030 [Zymo... 58 3e-06 >gb|EMF11137.1| hypothetical protein SEPMUDRAFT_134346 [Sphaerulina musiva SO2202] Length = 143 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -1 Query: 353 MPRDGSGHSHNAVEAGEHIIHGQPTGNEQPTGSGVDRSSK 234 MPRDGSGHSHNA EAG +I HG P GNEQPT SGVDRS K Sbjct: 1 MPRDGSGHSHNAEEAGHNIQHGAPQGNEQPTSSGVDRSGK 40 >ref|XP_003855783.1| hypothetical protein MYCGRDRAFT_103030 [Zymoseptoria tritici IPO323] gi|339475667|gb|EGP90759.1| hypothetical protein MYCGRDRAFT_103030 [Zymoseptoria tritici IPO323] gi|796696335|gb|KJX95025.1| hypothetical protein TI39_contig4141g00006 [Zymoseptoria brevis] Length = 77 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -1 Query: 353 MPRDGSGHSHNAVEAGEHIIHGQPTGNEQPTGSGVDRSSK 234 MPRDGSGHSHNAVE GE ++HG PTGN+ GS VDRS K Sbjct: 1 MPRDGSGHSHNAVE-GEELVHGAPTGND-GKGSEVDRSDK 38