BLASTX nr result
ID: Cornus23_contig00029292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029292 (440 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012483246.1| PREDICTED: putative F-box protein At3g23970 ... 49 1e-05 gb|KJB35389.1| hypothetical protein B456_006G112800 [Gossypium r... 49 1e-05 >ref|XP_012483246.1| PREDICTED: putative F-box protein At3g23970 [Gossypium raimondii] Length = 399 Score = 48.9 bits (115), Expect(2) = 1e-05 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = -2 Query: 292 ASPEGLILCSLQRFRVLHYYVCNPVKNQWFALPKPNNGHVPSSVSFSCKN 143 AS GL+LC + +YY+CNP+ QW ALPKP +V F CK+ Sbjct: 130 ASSNGLLLCCETFYWQKNYYICNPLIQQWIALPKPPKAIKSVAVGFICKD 179 Score = 26.9 bits (58), Expect(2) = 1e-05 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 137 KDGVVHFKIILAIFQKEERATYDRIYIETLSSQTGEWSKSFLTSP 3 KDG H+++I F + + +ET SS+TG+W S + P Sbjct: 178 KDG--HYEVIR--FPTANYGPSNTLRLETFSSETGKWHCSIVNCP 218 >gb|KJB35389.1| hypothetical protein B456_006G112800 [Gossypium raimondii] Length = 396 Score = 48.9 bits (115), Expect(2) = 1e-05 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = -2 Query: 292 ASPEGLILCSLQRFRVLHYYVCNPVKNQWFALPKPNNGHVPSSVSFSCKN 143 AS GL+LC + +YY+CNP+ QW ALPKP +V F CK+ Sbjct: 127 ASSNGLLLCCETFYWQKNYYICNPLIQQWIALPKPPKAIKSVAVGFICKD 176 Score = 26.9 bits (58), Expect(2) = 1e-05 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 137 KDGVVHFKIILAIFQKEERATYDRIYIETLSSQTGEWSKSFLTSP 3 KDG H+++I F + + +ET SS+TG+W S + P Sbjct: 175 KDG--HYEVIR--FPTANYGPSNTLRLETFSSETGKWHCSIVNCP 215