BLASTX nr result
ID: Cornus23_contig00029129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00029129 (293 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJY02458.1| acyl-CoA desaturase like protein [Zymoseptoria br... 79 2e-12 ref|XP_003853242.1| hypothetical protein MYCGRDRAFT_80591 [Zymos... 79 2e-12 gb|EMF10933.1| putative delta-9 desaturase protein A [Sphaerulin... 71 3e-10 ref|XP_007930367.1| hypothetical protein MYCFIDRAFT_212294 [Pseu... 66 9e-09 gb|EME38490.1| hypothetical protein DOTSEDRAFT_75875 [Dothistrom... 62 1e-07 gb|AAS91159.2| putative delta-9 desaturase protein A [Hortaea we... 60 6e-07 >gb|KJY02458.1| acyl-CoA desaturase like protein [Zymoseptoria brevis] Length = 485 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 293 MEVEIWKRQQKDGSGSQIYKDSDGNRIVRAGAQVTKVMEP 174 MEVEIWKR QKDG GSQIYKD+DGNRIVRAGAQ+TK+MEP Sbjct: 439 MEVEIWKRSQKDGQGSQIYKDADGNRIVRAGAQITKIMEP 478 >ref|XP_003853242.1| hypothetical protein MYCGRDRAFT_80591 [Zymoseptoria tritici IPO323] gi|339473124|gb|EGP88218.1| hypothetical protein MYCGRDRAFT_80591 [Zymoseptoria tritici IPO323] Length = 459 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 293 MEVEIWKRQQKDGSGSQIYKDSDGNRIVRAGAQVTKVMEP 174 MEVEIWKR QKDG GSQIYKD+DGNRIVRAGAQ+TK+MEP Sbjct: 413 MEVEIWKRSQKDGQGSQIYKDADGNRIVRAGAQITKIMEP 452 >gb|EMF10933.1| putative delta-9 desaturase protein A [Sphaerulina musiva SO2202] Length = 483 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 293 MEVEIWKRQQKDGSGSQIYKDSDGNRIVRAGAQVTKVMEP 174 MEVEIWKR +K+ GSQIYKDSDGNRIVRAGAQ+TKV++P Sbjct: 437 MEVEIWKRAEKESQGSQIYKDSDGNRIVRAGAQLTKVIQP 476 >ref|XP_007930367.1| hypothetical protein MYCFIDRAFT_212294 [Pseudocercospora fijiensis CIRAD86] gi|452979959|gb|EME79721.1| hypothetical protein MYCFIDRAFT_212294 [Pseudocercospora fijiensis CIRAD86] Length = 486 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -1 Query: 293 MEVEIWKRQQKDGSGSQIYKDSDGNRIVRAGAQVTKVMEP 174 MEVEIWKR Q + GS IYKD GNRIVRAGAQVTKV++P Sbjct: 440 MEVEIWKRSQNEAKGSMIYKDEQGNRIVRAGAQVTKVIQP 479 >gb|EME38490.1| hypothetical protein DOTSEDRAFT_75875 [Dothistroma septosporum NZE10] Length = 482 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -1 Query: 293 MEVEIWKRQQKDGSGSQIYKDSDGNRIVRAGAQVTKVMEP 174 MEVEIWKRQ + GSQIYKD GNRIVRAGAQVTKV+ P Sbjct: 437 MEVEIWKRQS-ESQGSQIYKDEKGNRIVRAGAQVTKVINP 475 >gb|AAS91159.2| putative delta-9 desaturase protein A [Hortaea werneckii] Length = 483 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -1 Query: 293 MEVEIWKRQQKDGSGSQIYKDSDGNRIVRAGAQVTKVMEP 174 MEVEIWKR DG GS I KD +G RIVRAG QVTKV +P Sbjct: 437 MEVEIWKRANNDGKGSMIVKDENGQRIVRAGEQVTKVYDP 476