BLASTX nr result
ID: Cornus23_contig00028985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00028985 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001793513.1| hypothetical protein SNOG_02920 [Parastagono... 57 4e-06 ref|XP_003845944.1| hypothetical protein LEMA_P012520.1 [Leptosp... 56 9e-06 >ref|XP_001793513.1| hypothetical protein SNOG_02920 [Parastagonospora nodorum SN15] gi|111068531|gb|EAT89651.1| hypothetical protein SNOG_02920 [Parastagonospora nodorum SN15] Length = 385 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 91 MLTFKKALVLSLACLTLFFLFKSQHQNTAP 2 MLTFKKALVLSLACLTLFFLFKS HQ++AP Sbjct: 1 MLTFKKALVLSLACLTLFFLFKSHHQSSAP 30 >ref|XP_003845944.1| hypothetical protein LEMA_P012520.1 [Leptosphaeria maculans JN3] gi|312222525|emb|CBY02465.1| hypothetical protein LEMA_P012520.1 [Leptosphaeria maculans JN3] Length = 386 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 91 MLTFKKALVLSLACLTLFFLFKSQHQNTAP 2 MLTFKKALVLSLACLTLFF+FKS H NT P Sbjct: 1 MLTFKKALVLSLACLTLFFMFKSHHTNTTP 30