BLASTX nr result
ID: Cornus23_contig00028460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00028460 (323 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425857.1| hypothetical protein CICLE_v10027209mg [Citr... 62 2e-07 >ref|XP_006425857.1| hypothetical protein CICLE_v10027209mg [Citrus clementina] gi|557527847|gb|ESR39097.1| hypothetical protein CICLE_v10027209mg [Citrus clementina] gi|641860598|gb|KDO79287.1| hypothetical protein CISIN_1g040634mg [Citrus sinensis] Length = 119 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/65 (50%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = +2 Query: 44 MAQTKLVFASVFLVLIFVLEIQCSEGRNIKLGKKNRFVKLQTHTKIFEKETKNI-AQHNS 220 MAQ KL F + LVLIF EIQ E RN+KL ++ + KLQT+ K EKE K I + N+ Sbjct: 1 MAQNKLTFVCLLLVLIFCQEIQSIEARNLKLEREQKTPKLQTYNKALEKELKEINPEKNT 60 Query: 221 NMQGD 235 N+ GD Sbjct: 61 NLHGD 65