BLASTX nr result
ID: Cornus23_contig00028318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00028318 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007026615.1| Myb-like HTH transcriptional regulator famil... 59 2e-06 >ref|XP_007026615.1| Myb-like HTH transcriptional regulator family protein, putative isoform 1 [Theobroma cacao] gi|590628058|ref|XP_007026616.1| Myb-like HTH transcriptional regulator family protein, putative isoform 1 [Theobroma cacao] gi|508715220|gb|EOY07117.1| Myb-like HTH transcriptional regulator family protein, putative isoform 1 [Theobroma cacao] gi|508715221|gb|EOY07118.1| Myb-like HTH transcriptional regulator family protein, putative isoform 1 [Theobroma cacao] Length = 368 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -3 Query: 168 MEGSGGTECSKTNPXXXXXXXXXXXXXXDG-CQPKDGASSSNSTVEETEKRGSVRPY 1 MEG+ GTECSKT+P DG +PK+G SSSNSTVEE EK+ SVRPY Sbjct: 1 MEGNNGTECSKTSPSKQNQAESESTEENDGESRPKNGGSSSNSTVEENEKKPSVRPY 57