BLASTX nr result
ID: Cornus23_contig00028220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00028220 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001798270.1| hypothetical protein SNOG_07944 [Parastagono... 76 1e-11 >ref|XP_001798270.1| hypothetical protein SNOG_07944 [Parastagonospora nodorum SN15] gi|111063100|gb|EAT84220.1| hypothetical protein SNOG_07944 [Parastagonospora nodorum SN15] Length = 381 Score = 75.9 bits (185), Expect = 1e-11 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 150 TPTLQQALNSSADLSQLNAVLALNPQLAQSLSSAQNITILAPSNRAFSRVDNATLS 317 TP+L QALNSS DL+ L+ VL L P+L +L SAQNITILAPSN AF++VDNATLS Sbjct: 20 TPSLVQALNSSTDLTTLSTVLGLVPELVTALGSAQNITILAPSNAAFAKVDNATLS 75