BLASTX nr result
ID: Cornus23_contig00027428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00027428 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010236425.1| PREDICTED: uncharacterized protein LOC104584... 57 7e-06 >ref|XP_010236425.1| PREDICTED: uncharacterized protein LOC104584027 [Brachypodium distachyon] Length = 285 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/61 (37%), Positives = 37/61 (60%) Frame = +1 Query: 103 WSVLCNRFMSEKHQEISEQNQQNRGALEVHHCGGSKSFVRYIEESKMSENEDEPRLVDVY 282 W +LCNR+ + Q + +N+QNR + H C GS+S+V ++ K N +EP +VD Y Sbjct: 132 WELLCNRWSNPDFQRLCAKNKQNRERVRQHQCTGSRSYVAHLTFCKAKYNNEEPEVVDFY 191 Query: 283 E 285 + Sbjct: 192 K 192