BLASTX nr result
ID: Cornus23_contig00027045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00027045 (838 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citr... 61 9e-07 >ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] gi|557537661|gb|ESR48768.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 61.2 bits (147), Expect = 9e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 269 PQAME*RIIPDLH*GIDGDS*IS*TKM*YNEIECNRNKDT 150 P+ ME RIIPDLH GIDGDS IS +M Y+EIECNRNKDT Sbjct: 38 PRTMEQRIIPDLHRGIDGDSQISQNRMGYDEIECNRNKDT 77