BLASTX nr result
ID: Cornus23_contig00027003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00027003 (885 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008609974.1| hypothetical protein SDRG_06001 [Saprolegnia... 59 4e-06 >ref|XP_008609974.1| hypothetical protein SDRG_06001 [Saprolegnia diclina VS20] gi|530738311|gb|EQC36553.1| hypothetical protein SDRG_06001 [Saprolegnia diclina VS20] Length = 125 Score = 59.3 bits (142), Expect = 4e-06 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 5/72 (6%) Frame = -1 Query: 795 GACGSVCFDQTNYQCCNGQLQQK-----GQTCSGATNSPSSAPTNAPTNAPTSAPTNSPT 631 G+ G CF+ + C Q T++P+SAPT+APT+APTSAPT++PT Sbjct: 3 GSDGGYCFNDVDKDSCVAWGQPYVACYLDTPTQQPTSAPTSAPTSAPTSAPTSAPTSAPT 62 Query: 630 SVVTQAPARNNC 595 S T APA N+C Sbjct: 63 SAPTSAPASNDC 74