BLASTX nr result
ID: Cornus23_contig00026636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026636 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001793671.1| hypothetical protein SNOG_03084 [Parastagono... 67 5e-09 ref|XP_003306812.1| hypothetical protein PTT_20055 [Pyrenophora ... 63 8e-08 ref|XP_001932334.1| conserved hypothetical protein [Pyrenophora ... 63 8e-08 ref|XP_007683712.1| hypothetical protein COCMIDRAFT_83533 [Bipol... 59 1e-06 ref|XP_007708388.1| hypothetical protein COCCADRAFT_85789 [Bipol... 59 1e-06 ref|XP_014075602.1| hypothetical protein COCC4DRAFT_99197, parti... 59 1e-06 gb|EMD95017.1| hypothetical protein COCHEDRAFT_1129108, partial ... 59 1e-06 ref|XP_007697820.1| hypothetical protein COCSADRAFT_158415 [Bipo... 59 1e-06 gb|KNG45031.1| hypothetical protein TW65_08102 [Stemphylium lyco... 58 2e-06 ref|XP_008027563.1| hypothetical protein SETTUDRAFT_163808 [Seto... 58 3e-06 >ref|XP_001793671.1| hypothetical protein SNOG_03084 [Parastagonospora nodorum SN15] gi|111068695|gb|EAT89815.1| hypothetical protein SNOG_03084 [Parastagonospora nodorum SN15] Length = 303 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 118 RPMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 RPMRR EKAYF+LE+L SD GYD DIEI+RPD +EDAKS Sbjct: 114 RPMRRTEKAYFVLEELESDPGYDSDIEIVRPDHFEDAKS 152 >ref|XP_003306812.1| hypothetical protein PTT_20055 [Pyrenophora teres f. teres 0-1] gi|311315511|gb|EFQ85091.1| hypothetical protein PTT_20055 [Pyrenophora teres f. teres 0-1] Length = 306 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 118 RPMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 RP+RR E+A FILE+L SD GYDCD+EI+RPD EDAKS Sbjct: 122 RPVRRVERAQFILEELDSDPGYDCDVEILRPDHCEDAKS 160 >ref|XP_001932334.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973940|gb|EDU41439.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 306 Score = 63.2 bits (152), Expect = 8e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 118 RPMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 RP+RR E+A FILE+L SD GYDCD+EI+RPD EDAKS Sbjct: 122 RPVRRVERAQFILEELDSDPGYDCDVEILRPDHCEDAKS 160 >ref|XP_007683712.1| hypothetical protein COCMIDRAFT_83533 [Bipolaris oryzae ATCC 44560] gi|576936382|gb|EUC49878.1| hypothetical protein COCMIDRAFT_83533 [Bipolaris oryzae ATCC 44560] Length = 304 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P+RR EKA FILE+L D GYDCD+E+++PD EDAKS Sbjct: 119 PLRRVEKAQFILEELDDDPGYDCDVEVLQPDHCEDAKS 156 >ref|XP_007708388.1| hypothetical protein COCCADRAFT_85789 [Bipolaris zeicola 26-R-13] gi|953432857|ref|XP_014558500.1| hypothetical protein COCVIDRAFT_14340 [Bipolaris victoriae FI3] gi|576923219|gb|EUC37339.1| hypothetical protein COCCADRAFT_85789 [Bipolaris zeicola 26-R-13] gi|578491541|gb|EUN28947.1| hypothetical protein COCVIDRAFT_14340 [Bipolaris victoriae FI3] Length = 305 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P+RR EKA FILE+L D GYDCD+E+++PD EDAKS Sbjct: 120 PLRRVEKAQFILEELDDDPGYDCDVEVLQPDHCEDAKS 157 >ref|XP_014075602.1| hypothetical protein COCC4DRAFT_99197, partial [Bipolaris maydis ATCC 48331] gi|477584602|gb|ENI01693.1| hypothetical protein COCC4DRAFT_99197, partial [Bipolaris maydis ATCC 48331] Length = 299 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P+RR EKA FILE+L D GYDCD+E+++PD EDAKS Sbjct: 119 PLRRVEKAQFILEELDDDPGYDCDVEVLQPDHCEDAKS 156 >gb|EMD95017.1| hypothetical protein COCHEDRAFT_1129108, partial [Bipolaris maydis C5] Length = 304 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P+RR EKA FILE+L D GYDCD+E+++PD EDAKS Sbjct: 119 PLRRVEKAQFILEELDDDPGYDCDVEVLQPDHCEDAKS 156 >ref|XP_007697820.1| hypothetical protein COCSADRAFT_158415 [Bipolaris sorokiniana ND90Pr] gi|451852995|gb|EMD66289.1| hypothetical protein COCSADRAFT_158415 [Bipolaris sorokiniana ND90Pr] Length = 304 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P+RR EKA FILE+L D GYDCD+E+++PD EDAKS Sbjct: 119 PLRRVEKAQFILEELDDDPGYDCDVEVLQPDHCEDAKS 156 >gb|KNG45031.1| hypothetical protein TW65_08102 [Stemphylium lycopersici] Length = 302 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P RR E+A F LE+L SD GYDCD+EI+RPD EDAKS Sbjct: 119 PKRRVERASFTLEELDSDPGYDCDVEILRPDHCEDAKS 156 >ref|XP_008027563.1| hypothetical protein SETTUDRAFT_163808 [Setosphaeria turcica Et28A] gi|482808149|gb|EOA85082.1| hypothetical protein SETTUDRAFT_163808 [Setosphaeria turcica Et28A] Length = 306 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -3 Query: 115 PMRRAEKAYFILEDLGSDLGYDCDIEIIRPDQYEDAKS 2 P+RR + A F+LE+L SD GYDCD+EI+RPD EDA+S Sbjct: 123 PLRRVDHAQFVLEELDSDPGYDCDVEILRPDHCEDARS 160