BLASTX nr result
ID: Cornus23_contig00026552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026552 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDY67014.1| BnaUnng01810D, partial [Brassica napus] 66 9e-09 ref|XP_006354268.1| PREDICTED: uncharacterized protein LOC102588... 64 4e-08 emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] 64 4e-08 ref|XP_002534687.1| NADH-ubiquinone oxidoreductase chain, putati... 60 5e-07 >emb|CDY67014.1| BnaUnng01810D, partial [Brassica napus] Length = 451 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 224 FSTQALFGPAQFSHPSVQCTGLISWREKPKCS 319 FS ALFGPAQFS+PSVQCTGLISWREKPKCS Sbjct: 59 FSAPALFGPAQFSYPSVQCTGLISWREKPKCS 90 >ref|XP_006354268.1| PREDICTED: uncharacterized protein LOC102588707 [Solanum tuberosum] Length = 610 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 213 YLCVLAPKRFLGQLSSLIHRSNALGSSHGGKSQNV 317 Y+ APKRFLGQLSSLIHRSNALGSSHGGKSQNV Sbjct: 546 YIVRRAPKRFLGQLSSLIHRSNALGSSHGGKSQNV 580 >emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] Length = 325 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 213 YLCVLAPKRFLGQLSSLIHRSNALGSSHGGKSQNV 317 Y+ APKRFLGQLSSLIHRSNALGSSHGGKSQNV Sbjct: 56 YIVRRAPKRFLGQLSSLIHRSNALGSSHGGKSQNV 90 >ref|XP_002534687.1| NADH-ubiquinone oxidoreductase chain, putative [Ricinus communis] gi|223524771|gb|EEF27701.1| NADH-ubiquinone oxidoreductase chain, putative [Ricinus communis] Length = 366 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 213 YLCVLAPKRFLGQLSSLIHRSNALGSSHGGKSQNV 317 Y+ APKRFLGQLSSLIHRSNALGSSHGGK +NV Sbjct: 300 YILRRAPKRFLGQLSSLIHRSNALGSSHGGKRKNV 334