BLASTX nr result
ID: Cornus23_contig00026501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026501 (796 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014554652.1| hypothetical protein COCVIDRAFT_39527 [Bipol... 59 4e-06 ref|XP_007708079.1| hypothetical protein COCCADRAFT_33208 [Bipol... 59 4e-06 ref|XP_014082457.1| hypothetical protein COCC4DRAFT_57286 [Bipol... 59 4e-06 >ref|XP_014554652.1| hypothetical protein COCVIDRAFT_39527 [Bipolaris victoriae FI3] gi|578487621|gb|EUN25076.1| hypothetical protein COCVIDRAFT_39527 [Bipolaris victoriae FI3] Length = 659 Score = 58.9 bits (141), Expect = 4e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 672 LHTYTSPCHTSLPSS-TTIAVASRFVENLEEVPITHPHLNVSLEDIL 535 L T T P H P + TT +ASRFVENLEEVP +HPHLNVSL+DIL Sbjct: 559 LFTTTHPYHYIQPQTPTTTTMASRFVENLEEVPNSHPHLNVSLDDIL 605 >ref|XP_007708079.1| hypothetical protein COCCADRAFT_33208 [Bipolaris zeicola 26-R-13] gi|576923565|gb|EUC37682.1| hypothetical protein COCCADRAFT_33208 [Bipolaris zeicola 26-R-13] Length = 659 Score = 58.9 bits (141), Expect = 4e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -2 Query: 672 LHTYTSPCHTSLPSS-TTIAVASRFVENLEEVPITHPHLNVSLEDIL 535 L T T P H P + TT +ASRFVENLEEVP +HPHLNVSL+DIL Sbjct: 559 LFTTTHPYHYIQPQTPTTTTMASRFVENLEEVPNSHPHLNVSLDDIL 605 >ref|XP_014082457.1| hypothetical protein COCC4DRAFT_57286 [Bipolaris maydis ATCC 48331] gi|451999231|gb|EMD91694.1| hypothetical protein COCHEDRAFT_1102729 [Bipolaris maydis C5] gi|477591476|gb|ENI08548.1| hypothetical protein COCC4DRAFT_57286 [Bipolaris maydis ATCC 48331] Length = 663 Score = 58.9 bits (141), Expect = 4e-06 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -2 Query: 678 SRLHTYTSPCHTSLPSSTTIAVASRFVENLEEVPITHPHLNVSLEDIL 535 S+L T+T+ + +L +ASRFVENLEEVPI+HPHLNVSL+DIL Sbjct: 562 SQLPTHTTTFNHNLAQLLLATMASRFVENLEEVPISHPHLNVSLDDIL 609