BLASTX nr result
ID: Cornus23_contig00026364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026364 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274756.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_010274683.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_010693912.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 gb|KNA22345.1| hypothetical protein SOVF_035000 [Spinacia oleracea] 79 1e-12 ref|XP_008381324.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-11 ref|XP_007215347.1| hypothetical protein PRUPE_ppa005397mg [Prun... 75 3e-11 ref|XP_009371795.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_008460516.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_012077781.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_002272930.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_010032676.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_008362562.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 70 6e-10 ref|XP_006383312.1| hypothetical protein POPTR_0005s14380g, part... 70 8e-10 emb|CBI33534.3| unnamed protein product [Vitis vinifera] 69 1e-09 ref|XP_011099477.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_002532468.1| pentatricopeptide repeat-containing protein,... 67 4e-09 ref|XP_004140363.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_011021408.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_011021407.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_008368730.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 65 2e-08 >ref|XP_010274756.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Nelumbo nucifera] Length = 320 Score = 82.4 bits (202), Expect = 1e-13 Identities = 47/97 (48%), Positives = 54/97 (55%) Frame = -3 Query: 292 MDMNKKRSRRHDSSPSSLNVDHNXXXXXXXXXXXXXXSAQIQQQQMGKRPNFSSYLQTPN 113 MD NKKRS R D S Q Q Q+ +RP F SYL++PN Sbjct: 1 MDRNKKRSSRDDDSSKPEQNKKRQSSSYANPASDEGPEQQKQNQRQSRRPAFISYLESPN 60 Query: 112 LPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 LPPK KLLCEIIANT VEKVL++TGV V+ DVE Sbjct: 61 LPPKTKLLCEIIANTPSPTVEKVLEETGVRVTTGDVE 97 >ref|XP_010274683.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Nelumbo nucifera] Length = 508 Score = 82.4 bits (202), Expect = 1e-13 Identities = 47/97 (48%), Positives = 54/97 (55%) Frame = -3 Query: 292 MDMNKKRSRRHDSSPSSLNVDHNXXXXXXXXXXXXXXSAQIQQQQMGKRPNFSSYLQTPN 113 MD NKKRS R D S Q Q Q+ +RP F SYL++PN Sbjct: 1 MDRNKKRSSRDDDSSKPEQNKKRQSSSYANPASDEGPEQQKQNQRQSRRPAFISYLESPN 60 Query: 112 LPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 LPPK KLLCEIIANT VEKVL++TGV V+ DVE Sbjct: 61 LPPKTKLLCEIIANTPSPTVEKVLEETGVRVTTGDVE 97 >ref|XP_010693912.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870867783|gb|KMT18652.1| hypothetical protein BVRB_2g027810 [Beta vulgaris subsp. vulgaris] Length = 504 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/58 (67%), Positives = 46/58 (79%) Frame = -3 Query: 175 QIQQQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 Q Q +GKRPNF SYL++PNLPPKIKL+CEI+ANT VEKVLDD + VSQ+DVE Sbjct: 36 QRQIHDLGKRPNFVSYLESPNLPPKIKLICEIVANTPSSSVEKVLDDNVIRVSQEDVE 93 >gb|KNA22345.1| hypothetical protein SOVF_035000 [Spinacia oleracea] Length = 505 Score = 79.0 bits (193), Expect = 1e-12 Identities = 45/97 (46%), Positives = 57/97 (58%), Gaps = 2/97 (2%) Frame = -3 Query: 286 MNKKRSRRH--DSSPSSLNVDHNXXXXXXXXXXXXXXSAQIQQQQMGKRPNFSSYLQTPN 113 M ++ RRH D SPS L+ + + +QQ RPNF SYL +PN Sbjct: 1 MTRQSKRRHGRDRSPSPLSSKKHHHQHRSHGKSPQRQIHDVGKQQ---RPNFISYLDSPN 57 Query: 112 LPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 LP KIKL+CEI+ANT L VEK+LDD + VSQ+DVE Sbjct: 58 LPSKIKLICEIVANTPSLSVEKLLDDNSIRVSQEDVE 94 >ref|XP_008381324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Malus domestica] Length = 535 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 166 QQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 Q + KRP F+SYL TPNLPP I LLCEI+A TH L VE+ L++TGV V+Q+DVE Sbjct: 70 QTPVAKRPTFASYLDTPNLPPXIGLLCEILAKTHTLSVEERLEETGVRVTQEDVE 124 >ref|XP_007215347.1| hypothetical protein PRUPE_ppa005397mg [Prunus persica] gi|462411497|gb|EMJ16546.1| hypothetical protein PRUPE_ppa005397mg [Prunus persica] Length = 463 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -3 Query: 157 MGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 M KRP F+SYL TPNLPPKI+LLCEI+A TH L VE+ L +T V V+Q+DVE Sbjct: 1 MPKRPTFASYLDTPNLPPKIRLLCEIVAKTHTLSVEERLAETSVRVTQEDVE 52 >ref|XP_009371795.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Pyrus x bretschneideri] Length = 535 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 166 QQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 Q + KRP F+SYL TPNLPPKI LLCEI+A TH VE+ L++TGV V+Q+DVE Sbjct: 70 QTPVAKRPTFASYLDTPNLPPKIGLLCEILAKTHTPSVEERLEETGVRVTQEDVE 124 >ref|XP_008460516.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis melo] gi|659121140|ref|XP_008460517.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis melo] gi|659121142|ref|XP_008460519.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis melo] Length = 519 Score = 72.0 bits (175), Expect = 2e-10 Identities = 40/100 (40%), Positives = 55/100 (55%) Frame = -3 Query: 301 REIMDMNKKRSRRHDSSPSSLNVDHNXXXXXXXXXXXXXXSAQIQQQQMGKRPNFSSYLQ 122 R + D +RS++H S S + + + Q P+F SYL Sbjct: 7 RRLSDHTHQRSKKHLPSSSPSSATPSPIPSNSLSHQTHFHNPSPQPPHKNSTPHFLSYLD 66 Query: 121 TPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 PNLP KIKL+CEIIAN+ L+VEK L+DTG+ V+Q+DVE Sbjct: 67 FPNLPFKIKLMCEIIANSPSLNVEKALEDTGIHVTQEDVE 106 >ref|XP_012077781.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Jatropha curcas] gi|643723713|gb|KDP33157.1| hypothetical protein JCGZ_13422 [Jatropha curcas] Length = 510 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/59 (61%), Positives = 40/59 (67%) Frame = -3 Query: 178 AQIQQQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 A+ Q KRPNF SY+ TPNLP KIKLLCE+IANT VE + D GV VSQ DVE Sbjct: 41 AEHQSSYSPKRPNFPSYIDTPNLPSKIKLLCELIANTPSSAVESAITDAGVRVSQSDVE 99 >ref|XP_002272930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] gi|731417498|ref|XP_010660324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] Length = 502 Score = 72.0 bits (175), Expect = 2e-10 Identities = 42/97 (43%), Positives = 51/97 (52%) Frame = -3 Query: 292 MDMNKKRSRRHDSSPSSLNVDHNXXXXXXXXXXXXXXSAQIQQQQMGKRPNFSSYLQTPN 113 M KR SSP L+ DH Q KRP+F +YL+TPN Sbjct: 1 MGKKHKRPNHTASSPPPLHHDHRNKRHSSSTTD------SATHHQTPKRPSFPTYLETPN 54 Query: 112 LPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 L PK++LLCEIIANT VE+VL DT + VS +DVE Sbjct: 55 LSPKVRLLCEIIANTPSSTVEEVLHDTAIRVSPEDVE 91 >ref|XP_010032676.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Eucalyptus grandis] gi|629085756|gb|KCW52113.1| hypothetical protein EUGRSUZ_J01548 [Eucalyptus grandis] Length = 538 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = -3 Query: 178 AQIQQQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 A +Q++G+R NF+SYL PNLPPKI++LCEI+A T VE+VL D G+ V Q+DVE Sbjct: 66 APAPRQELGRRQNFNSYLDAPNLPPKIRVLCEIVARTPAHAVEEVLGDAGIGVGQEDVE 124 >ref|XP_008362562.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Malus domestica] Length = 478 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -3 Query: 166 QQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 Q + KRP FS YL TP LP KIK+LCEI+A TH + VE+ L++TGV V+Q+DVE Sbjct: 13 QTPIAKRPTFSLYLDTPYLPLKIKILCEILAKTHTISVEERLEETGVRVTQEDVE 67 >ref|XP_006383312.1| hypothetical protein POPTR_0005s14380g, partial [Populus trichocarpa] gi|550338919|gb|ERP61109.1| hypothetical protein POPTR_0005s14380g, partial [Populus trichocarpa] Length = 497 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = -3 Query: 151 KRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 K+P+F SYL+TPNLPP IKLLCEIIANT +VE VLD T + V Q DVE Sbjct: 35 KKPSFQSYLETPNLPPTIKLLCEIIANTPSHNVESVLDATVIRVKQTDVE 84 >emb|CBI33534.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = -3 Query: 160 QMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 Q KRP+F +YL+TPNL PK++LLCEIIANT VE+VL DT + VS +DVE Sbjct: 43 QTPKRPSFPTYLETPNLSPKVRLLCEIIANTPSSTVEEVLHDTAIRVSPEDVE 95 >ref|XP_011099477.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Sesamum indicum] Length = 517 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -3 Query: 166 QQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 QQ M KR +F SY + +LPPK+K+LCEI+A T + VE+VL+DTG+ VS++DVE Sbjct: 53 QQVMVKRSSFISYSEVSSLPPKVKILCEIVARTPAVTVERVLEDTGIRVSEEDVE 107 >ref|XP_002532468.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527826|gb|EEF29924.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 510 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = -3 Query: 151 KRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 K P F SYL+TPNL PKIKLLCEIIA VE +LD+TG+ VSQ DVE Sbjct: 50 KHPTFPSYLETPNLSPKIKLLCEIIAKIPSSTVETILDETGLYVSQYDVE 99 >ref|XP_004140363.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] gi|700195869|gb|KGN51046.1| hypothetical protein Csa_5G420290 [Cucumis sativus] Length = 519 Score = 67.4 bits (163), Expect = 4e-09 Identities = 38/100 (38%), Positives = 52/100 (52%) Frame = -3 Query: 301 REIMDMNKKRSRRHDSSPSSLNVDHNXXXXXXXXXXXXXXSAQIQQQQMGKRPNFSSYLQ 122 R + D +RS++H S S + + + P+F SYL Sbjct: 7 RRLSDHTHQRSKKHLPSSSPSSATPSPIPSNSLSHQTHFHNPSPHPPHKNSTPHFLSYLD 66 Query: 121 TPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 PNLP +IKL+CEIIAN+ L VEK L+DTG+ +QQDVE Sbjct: 67 FPNLPFQIKLMCEIIANSPSLDVEKALEDTGIHATQQDVE 106 >ref|XP_011021408.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like isoform X2 [Populus euphratica] Length = 399 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 151 KRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 ++P+F SYL+TPNLPP IK+LCEIIANT +VE VLD T + V Q DVE Sbjct: 35 RKPSFPSYLETPNLPPTIKILCEIIANTPSHNVEPVLDATVIRVKQTDVE 84 >ref|XP_011021407.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Populus euphratica] Length = 499 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 151 KRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 ++P+F SYL+TPNLPP IK+LCEIIANT +VE VLD T + V Q DVE Sbjct: 35 RKPSFPSYLETPNLPPTIKILCEIIANTPSHNVEPVLDATVIRVKQTDVE 84 >ref|XP_008368730.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Malus domestica] Length = 525 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/55 (52%), Positives = 42/55 (76%) Frame = -3 Query: 166 QQQMGKRPNFSSYLQTPNLPPKIKLLCEIIANTHPLHVEKVLDDTGVLVSQQDVE 2 Q + K P F+ YL TP+LP KI++LCEI+A TH ++VE+ L++ GV V+Q+DVE Sbjct: 61 QTPVAKCPTFALYLDTPDLPSKIRILCEILAKTHTIYVEERLEEIGVRVTQEDVE 115