BLASTX nr result
ID: Cornus23_contig00026256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026256 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF08924.1| hypothetical protein SEPMUDRAFT_151820 [Sphaeruli... 69 2e-09 >gb|EMF08924.1| hypothetical protein SEPMUDRAFT_151820 [Sphaerulina musiva SO2202] Length = 276 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/56 (67%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 374 TPL*ATGSSTSNSLHSFI-HPTFVFDTLHTFTMKTSSILAVLATAVLSNATPVPEE 210 +PL TGSSTSNSLHSF H TFVF+ + MKTS+ILA +ATAVLSNATP+ EE Sbjct: 48 SPLRPTGSSTSNSLHSFNKHTTFVFEPPLSVKMKTSTILAFIATAVLSNATPISEE 103