BLASTX nr result
ID: Cornus23_contig00026184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026184 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012092717.1| PREDICTED: probable leucine-rich repeat rece... 98 3e-18 gb|KDP20288.1| hypothetical protein JCGZ_06874 [Jatropha curcas] 98 3e-18 ref|XP_010999466.1| PREDICTED: probable receptor-like protein ki... 97 5e-18 ref|XP_006371148.1| hypothetical protein POPTR_0019s04600g [Popu... 97 5e-18 ref|XP_006388398.1| hypothetical protein POPTR_0198s00230g, part... 97 5e-18 ref|XP_004494769.2| PREDICTED: probable receptor-like protein ki... 97 6e-18 ref|XP_012569483.1| PREDICTED: probable receptor-like protein ki... 97 6e-18 ref|XP_002525474.1| serine-threonine protein kinase, plant-type,... 97 6e-18 ref|XP_011034435.1| PREDICTED: probable receptor-like protein ki... 96 1e-17 ref|XP_007030238.1| Serine-threonine protein kinase, plant-type,... 96 1e-17 ref|XP_012476733.1| PREDICTED: probable leucine-rich repeat rece... 96 1e-17 gb|KJB26613.1| hypothetical protein B456_004G250200 [Gossypium r... 96 1e-17 ref|XP_011077082.1| PREDICTED: somatic embryogenesis receptor ki... 96 1e-17 gb|KHG29308.1| hypothetical protein F383_15351 [Gossypium arboreum] 96 1e-17 ref|XP_010319933.1| PREDICTED: probable receptor-like protein ki... 96 1e-17 ref|XP_009792425.1| PREDICTED: putative wall-associated receptor... 96 1e-17 ref|XP_009792424.1| PREDICTED: serine/threonine-protein kinase P... 96 1e-17 ref|XP_003626508.1| tyrosine kinase family protein [Medicago tru... 96 1e-17 ref|XP_009337946.1| PREDICTED: probable receptor-like protein ki... 95 2e-17 ref|XP_006340518.1| PREDICTED: probable leucine-rich repeat rece... 95 2e-17 >ref|XP_012092717.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Jatropha curcas] Length = 573 Score = 97.8 bits (242), Expect = 3e-18 Identities = 50/72 (69%), Positives = 58/72 (80%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV+LQLLS +K +E Sbjct: 410 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVILQLLSGQKVIE 469 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 470 LDLDARDQLTRK 481 >gb|KDP20288.1| hypothetical protein JCGZ_06874 [Jatropha curcas] Length = 604 Score = 97.8 bits (242), Expect = 3e-18 Identities = 50/72 (69%), Positives = 58/72 (80%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV+LQLLS +K +E Sbjct: 441 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVILQLLSGQKVIE 500 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 501 LDLDARDQLTRK 512 >ref|XP_010999466.1| PREDICTED: probable receptor-like protein kinase At5g20050 [Populus euphratica] Length = 598 Score = 97.1 bits (240), Expect = 5e-18 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GTMGY+DPEYMS K TCASDIYSFGIV LQLLS +K +E Sbjct: 441 DFGLAKMLGMEESKVFTDVRGTMGYMDPEYMSNAKLTCASDIYSFGIVTLQLLSGQKVIE 500 Query: 365 LDICATDQLTRK 400 LD+ + DQLTRK Sbjct: 501 LDLDSRDQLTRK 512 >ref|XP_006371148.1| hypothetical protein POPTR_0019s04600g [Populus trichocarpa] gi|550316789|gb|ERP48945.1| hypothetical protein POPTR_0019s04600g [Populus trichocarpa] Length = 344 Score = 97.1 bits (240), Expect = 5e-18 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GTMGY+DPEYMS K TCASDIYSFGIV LQLLS +K +E Sbjct: 200 DFGLAKMLGMEESKVFTDVRGTMGYMDPEYMSNAKLTCASDIYSFGIVTLQLLSGQKVIE 259 Query: 365 LDICATDQLTRK 400 LD+ + DQLTRK Sbjct: 260 LDLDSRDQLTRK 271 >ref|XP_006388398.1| hypothetical protein POPTR_0198s00230g, partial [Populus trichocarpa] gi|550310132|gb|ERP47312.1| hypothetical protein POPTR_0198s00230g, partial [Populus trichocarpa] Length = 348 Score = 97.1 bits (240), Expect = 5e-18 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GTMGY+DPEYMS K TCASDIYSFGIV LQLLS +K +E Sbjct: 203 DFGLAKMLGMEESKVFTDVRGTMGYMDPEYMSNAKLTCASDIYSFGIVTLQLLSGQKVIE 262 Query: 365 LDICATDQLTRK 400 LD+ + DQLTRK Sbjct: 263 LDLDSRDQLTRK 274 >ref|XP_004494769.2| PREDICTED: probable receptor-like protein kinase At2g42960 isoform X2 [Cicer arietinum] Length = 582 Score = 96.7 bits (239), Expect = 6e-18 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KMMG +ESKV GT+GY+DPEYMS K TCASD+YSFGIV LQ+LS +K +E Sbjct: 432 DFGLSKMMGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDVYSFGIVALQILSGQKVIE 491 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 492 LDLDARDQLTRK 503 >ref|XP_012569483.1| PREDICTED: probable receptor-like protein kinase At5g18500 isoform X1 [Cicer arietinum] Length = 583 Score = 96.7 bits (239), Expect = 6e-18 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KMMG +ESKV GT+GY+DPEYMS K TCASD+YSFGIV LQ+LS +K +E Sbjct: 433 DFGLSKMMGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDVYSFGIVALQILSGQKVIE 492 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 493 LDLDARDQLTRK 504 >ref|XP_002525474.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223535287|gb|EEF36964.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 569 Score = 96.7 bits (239), Expect = 6e-18 Identities = 49/72 (68%), Positives = 58/72 (80%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV+LQLLS +K ++ Sbjct: 411 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVILQLLSGQKVID 470 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 471 LDLDARDQLTRK 482 >ref|XP_011034435.1| PREDICTED: probable receptor-like protein kinase At5g20050 [Populus euphratica] gi|743873606|ref|XP_011034436.1| PREDICTED: probable receptor-like protein kinase At5g20050 [Populus euphratica] Length = 597 Score = 95.9 bits (237), Expect = 1e-17 Identities = 50/72 (69%), Positives = 56/72 (77%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GTMGY+DPEYMS K TCASDIYSFGIV LQLLS +K +E Sbjct: 440 DFGLAKMLGMEESKVFTDVRGTMGYMDPEYMSNAKLTCASDIYSFGIVALQLLSGQKVIE 499 Query: 365 LDICATDQLTRK 400 LD+ A DQL RK Sbjct: 500 LDLDARDQLIRK 511 >ref|XP_007030238.1| Serine-threonine protein kinase, plant-type, putative [Theobroma cacao] gi|508718843|gb|EOY10740.1| Serine-threonine protein kinase, plant-type, putative [Theobroma cacao] Length = 596 Score = 95.9 bits (237), Expect = 1e-17 Identities = 49/72 (68%), Positives = 58/72 (80%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQLLS +K +E Sbjct: 436 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVALQLLSGQKVIE 495 Query: 365 LDICATDQLTRK 400 LD+ A++QLTRK Sbjct: 496 LDLDASEQLTRK 507 >ref|XP_012476733.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Gossypium raimondii] Length = 599 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQLLS +K E Sbjct: 439 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVALQLLSGQKVFE 498 Query: 365 LDICATDQLTRK 400 LD+ A++QLTRK Sbjct: 499 LDLDASEQLTRK 510 >gb|KJB26613.1| hypothetical protein B456_004G250200 [Gossypium raimondii] Length = 530 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQLLS +K E Sbjct: 370 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVALQLLSGQKVFE 429 Query: 365 LDICATDQLTRK 400 LD+ A++QLTRK Sbjct: 430 LDLDASEQLTRK 441 >ref|XP_011077082.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Sesamum indicum] Length = 592 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQLLS ++ +E Sbjct: 434 DFGLAKMLGMEESKVYTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVTLQLLSGQRVIE 493 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 494 LDLDARDQLTRK 505 >gb|KHG29308.1| hypothetical protein F383_15351 [Gossypium arboreum] Length = 353 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQLLS +K E Sbjct: 193 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVALQLLSGQKVFE 252 Query: 365 LDICATDQLTRK 400 LD+ A++QLTRK Sbjct: 253 LDLDASEQLTRK 264 >ref|XP_010319933.1| PREDICTED: probable receptor-like protein kinase At1g49730 [Solanum lycopersicum] Length = 703 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQ+LS +K +E Sbjct: 547 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDIYSFGIVALQVLSGQKVIE 606 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 607 LDLDARDQLTRK 618 >ref|XP_009792425.1| PREDICTED: putative wall-associated receptor kinase-like 16 isoform X2 [Nicotiana sylvestris] Length = 573 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL +MMG +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQ+LS +K +E Sbjct: 411 DFGLARMMGMEESKVFTDVIGTIGYMDPEYMSNAKLTCASDIYSFGIVTLQVLSGQKVIE 470 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 471 LDLDARDQLTRK 482 >ref|XP_009792424.1| PREDICTED: serine/threonine-protein kinase PBS1-like isoform X1 [Nicotiana sylvestris] Length = 584 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL +MMG +ESKV GT+GY+DPEYMS K TCASDIYSFGIV LQ+LS +K +E Sbjct: 422 DFGLARMMGMEESKVFTDVIGTIGYMDPEYMSNAKLTCASDIYSFGIVTLQVLSGQKVIE 481 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 482 LDLDARDQLTRK 493 >ref|XP_003626508.1| tyrosine kinase family protein [Medicago truncatula] gi|355501523|gb|AES82726.1| tyrosine kinase family protein [Medicago truncatula] Length = 544 Score = 95.5 bits (236), Expect = 1e-17 Identities = 48/72 (66%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL +MMG +ESKV GT+GY+DPEYMS K TCASD+YSFGIV LQ+LS +K +E Sbjct: 387 DFGLSRMMGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDVYSFGIVALQILSGQKVIE 446 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 447 LDLDARDQLTRK 458 >ref|XP_009337946.1| PREDICTED: probable receptor-like protein kinase At5g18500, partial [Pyrus x bretschneideri] Length = 581 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/72 (66%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYM++ K TCASD+YSFGIV LQLLS +K E Sbjct: 419 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMASAKLTCASDVYSFGIVALQLLSGQKVFE 478 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 479 LDLDARDQLTRK 490 >ref|XP_006340518.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770-like [Solanum tuberosum] Length = 588 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/72 (66%), Positives = 57/72 (79%), Gaps = 5/72 (6%) Frame = +2 Query: 200 DFGLPKMMGWDESKV-----GTMGYLDPEYMSTNKRTCASDIYSFGIVLLQLLSERKAME 364 DFGL KM+G +ESKV GT+GY+DPEYMS K TCASD+YSFGIV LQ+LS +K +E Sbjct: 427 DFGLAKMLGMEESKVFTDVRGTIGYMDPEYMSNAKLTCASDVYSFGIVALQVLSGQKVIE 486 Query: 365 LDICATDQLTRK 400 LD+ A DQLTRK Sbjct: 487 LDLDARDQLTRK 498