BLASTX nr result
ID: Cornus23_contig00026123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026123 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAO46358.1| hypothetical protein G7K_0590-t1 [Saitoella comp... 110 5e-22 ref|XP_002836051.1| hypothetical protein [Tuber melanosporum Mel... 109 7e-22 ref|XP_012738485.1| autophagy-like protein 8 [Pseudogymnoascus d... 109 7e-22 gb|KKY28847.1| putative autophagy protein 8 [Phaeomoniella chlam... 108 2e-21 gb|KFX89099.1| hypothetical protein O988_08760 [Pseudogymnoascus... 107 3e-21 ref|XP_011118737.1| hypothetical protein AOL_s00007g534 [Arthrob... 105 1e-20 gb|KDB12146.1| microtubule-associated protein [Ustilaginoidea vi... 104 3e-20 ref|XP_007338944.1| light chain 3 [Auricularia subglabra TFB-100... 103 4e-20 gb|EUC54649.1| autophagy protein Atg8 ubiquitin-like protein [Rh... 103 5e-20 ref|XP_011113047.1| hypothetical protein H072_7285 [Dactylellina... 103 5e-20 ref|XP_007914855.1| putative autophagic death protein aut7 idi- ... 103 5e-20 emb|CEJ94485.1| Putative Autophagy-related protein [Torrubiella ... 103 6e-20 ref|XP_003233511.1| autophagy protein 8 [Trichophyton rubrum CBS... 103 6e-20 dbj|GAP92827.1| putative autophagic death protein aut7 idi- [Ros... 102 8e-20 gb|KIV99970.1| hypothetical protein PV09_08481 [Verruconis gallo... 102 8e-20 dbj|GAM83596.1| hypothetical protein ANO11243_015840 [fungal sp.... 102 8e-20 gb|KEY69512.1| hypothetical protein S7711_02049 [Stachybotrys ch... 102 8e-20 ref|XP_003024736.1| hypothetical protein TRV_01085 [Trichophyton... 102 8e-20 ref|XP_003017344.1| hypothetical protein ARB_04224 [Arthroderma ... 102 8e-20 ref|XP_007792258.1| putative autophagic death protein aut7 idi- ... 102 8e-20 >dbj|GAO46358.1| hypothetical protein G7K_0590-t1 [Saitoella complicata NRRL Y-17804] Length = 885 Score = 110 bits (274), Expect = 5e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFGFEEL Sbjct: 832 RIKLSPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDGFLYITYSGENTFGFEEL 885 >ref|XP_002836051.1| hypothetical protein [Tuber melanosporum Mel28] gi|295629853|emb|CAZ80208.1| unnamed protein product [Tuber melanosporum] Length = 173 Score = 109 bits (273), Expect = 7e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFGFEEL Sbjct: 119 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGFEEL 172 >ref|XP_012738485.1| autophagy-like protein 8 [Pseudogymnoascus destructans 20631-21] gi|440631802|gb|ELR01721.1| autophagy-like protein 8 [Pseudogymnoascus destructans 20631-21] gi|682294818|gb|KFY09325.1| hypothetical protein V492_05527 [Pseudogymnoascus pannorum VKM F-4246] gi|682337659|gb|KFY33878.1| hypothetical protein V494_07242 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] gi|682391905|gb|KFY71569.1| hypothetical protein V499_08229 [Pseudogymnoascus pannorum VKM F-103] gi|682413516|gb|KFY85203.1| hypothetical protein V500_08623 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682449254|gb|KFZ09163.1| hypothetical protein V502_08894 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] gi|682465956|gb|KFZ20473.1| hypothetical protein V501_00113 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 121 Score = 109 bits (273), Expect = 7e-22 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFGFEEL Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGFEEL 120 >gb|KKY28847.1| putative autophagy protein 8 [Phaeomoniella chlamydospora] Length = 120 Score = 108 bits (269), Expect = 2e-21 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEE 163 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFGFEE Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGFEE 119 >gb|KFX89099.1| hypothetical protein O988_08760 [Pseudogymnoascus pannorum VKM F-3808] gi|682262107|gb|KFX89273.1| hypothetical protein V490_07131 [Pseudogymnoascus pannorum VKM F-3557] gi|682303559|gb|KFY14542.1| hypothetical protein V491_06006 [Pseudogymnoascus pannorum VKM F-3775] gi|682326368|gb|KFY27392.1| hypothetical protein V493_03515 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] gi|682342941|gb|KFY37086.1| hypothetical protein V495_07389 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682370138|gb|KFY55637.1| hypothetical protein V497_06806 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] gi|682385597|gb|KFY67627.1| hypothetical protein V496_01518 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682419013|gb|KFY88983.1| hypothetical protein V498_06571 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 121 Score = 107 bits (267), Expect = 3e-21 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG EEL Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGLEEL 120 >ref|XP_011118737.1| hypothetical protein AOL_s00007g534 [Arthrobotrys oligospora ATCC 24927] gi|345569776|gb|EGX52603.1| hypothetical protein AOL_s00007g534 [Arthrobotrys oligospora ATCC 24927] Length = 122 Score = 105 bits (263), Expect = 1e-20 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG+E L Sbjct: 68 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGYEYL 121 >gb|KDB12146.1| microtubule-associated protein [Ustilaginoidea virens] gi|781086559|dbj|GAO15026.1| hypothetical protein UVI_021620 [Ustilaginoidea virens] Length = 121 Score = 104 bits (259), Expect = 3e-20 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGF 169 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFGF Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGF 117 >ref|XP_007338944.1| light chain 3 [Auricularia subglabra TFB-10046 SS5] gi|393245858|gb|EJD53368.1| light chain 3 [Auricularia subglabra TFB-10046 SS5] Length = 122 Score = 103 bits (258), Expect = 4e-20 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEE 163 RIKL+PEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLY+TYSGENTFG EE Sbjct: 67 RIKLAPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDGFLYVTYSGENTFGCEE 119 >gb|EUC54649.1| autophagy protein Atg8 ubiquitin-like protein [Rhizoctonia solani AG-3 Rhs1AP] gi|660966726|gb|KEP51152.1| autophagy protein Atg8 ubiquitin-like protein [Rhizoctonia solani 123E] Length = 119 Score = 103 bits (257), Expect = 5e-20 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKL+PEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLY++YSGENTFGFE Sbjct: 67 RIKLAPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDGFLYVSYSGENTFGFE 118 >ref|XP_011113047.1| hypothetical protein H072_7285 [Dactylellina haptotyla CBS 200.50] gi|526197728|gb|EPS38971.1| hypothetical protein H072_7285 [Dactylellina haptotyla CBS 200.50] Length = 122 Score = 103 bits (257), Expect = 5e-20 Identities = 51/54 (94%), Positives = 51/54 (94%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E L Sbjct: 68 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDEYL 121 >ref|XP_007914855.1| putative autophagic death protein aut7 idi- protein [Togninia minima UCRPA7] gi|500257280|gb|EOO00431.1| putative autophagic death protein aut7 idi- protein [Phaeoacremonium minimum UCRPA7] Length = 122 Score = 103 bits (257), Expect = 5e-20 Identities = 52/54 (96%), Positives = 52/54 (96%), Gaps = 1/54 (1%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFG-FEE 163 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG FEE Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDFEE 120 >emb|CEJ94485.1| Putative Autophagy-related protein [Torrubiella hemipterigena] Length = 118 Score = 103 bits (256), Expect = 6e-20 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGSE 118 >ref|XP_003233511.1| autophagy protein 8 [Trichophyton rubrum CBS 118892] gi|326464817|gb|EGD90270.1| hypothetical protein TERG_06497 [Trichophyton rubrum CBS 118892] gi|607879864|gb|EZF24778.1| hypothetical protein H100_02749 [Trichophyton rubrum MR850] gi|607906600|gb|EZF43830.1| hypothetical protein H102_02742 [Trichophyton rubrum CBS 100081] gi|607918696|gb|EZF54471.1| hypothetical protein H103_02753 [Trichophyton rubrum CBS 288.86] gi|607930811|gb|EZF65144.1| hypothetical protein H104_02732 [Trichophyton rubrum CBS 289.86] gi|607942765|gb|EZF75811.1| hypothetical protein H105_02759 [Trichophyton soudanense CBS 452.61] gi|607954792|gb|EZF86407.1| hypothetical protein H110_02751 [Trichophyton rubrum MR1448] gi|607967048|gb|EZF97232.1| hypothetical protein H113_02754 [Trichophyton rubrum MR1459] gi|607980411|gb|EZG09365.1| hypothetical protein H106_01573 [Trichophyton rubrum CBS 735.88] gi|607990983|gb|EZG18724.1| hypothetical protein H107_02828 [Trichophyton rubrum CBS 202.88] gi|633061026|gb|KDB35586.1| hypothetical protein H112_02743 [Trichophyton rubrum D6] gi|861296960|gb|KMQ41483.1| hypothetical protein HL42_7830 [Trichophyton rubrum] Length = 122 Score = 103 bits (256), Expect = 6e-20 Identities = 52/55 (94%), Positives = 52/55 (94%), Gaps = 1/55 (1%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFG-FEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG F EL Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGSFSEL 121 >dbj|GAP92827.1| putative autophagic death protein aut7 idi- [Rosellinia necatrix] Length = 119 Score = 102 bits (255), Expect = 8e-20 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEE 118 >gb|KIV99970.1| hypothetical protein PV09_08481 [Verruconis gallopava] Length = 119 Score = 102 bits (255), Expect = 8e-20 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDE 118 >dbj|GAM83596.1| hypothetical protein ANO11243_015840 [fungal sp. No.11243] Length = 119 Score = 102 bits (255), Expect = 8e-20 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEE 118 >gb|KEY69512.1| hypothetical protein S7711_02049 [Stachybotrys chartarum IBT 7711] gi|667524480|gb|KFA53294.1| hypothetical protein S40293_04691 [Stachybotrys chartarum IBT 40293] gi|667722157|gb|KFA64369.1| hypothetical protein S40285_02912 [Stachybotrys chlorohalonata IBT 40285] gi|667739151|gb|KFA78271.1| hypothetical protein S40288_02630 [Stachybotrys chartarum IBT 40288] Length = 120 Score = 102 bits (255), Expect = 8e-20 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEE 118 >ref|XP_003024736.1| hypothetical protein TRV_01085 [Trichophyton verrucosum HKI 0517] gi|291188805|gb|EFE44125.1| hypothetical protein TRV_01085 [Trichophyton verrucosum HKI 0517] Length = 216 Score = 102 bits (255), Expect = 8e-20 Identities = 52/55 (94%), Positives = 52/55 (94%), Gaps = 1/55 (1%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFG-FEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG F EL Sbjct: 161 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGSFPEL 215 >ref|XP_003017344.1| hypothetical protein ARB_04224 [Arthroderma benhamiae CBS 112371] gi|291180915|gb|EFE36699.1| hypothetical protein ARB_04224 [Arthroderma benhamiae CBS 112371] Length = 223 Score = 102 bits (255), Expect = 8e-20 Identities = 52/55 (94%), Positives = 52/55 (94%), Gaps = 1/55 (1%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFG-FEEL 160 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG F EL Sbjct: 168 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGSFPEL 222 >ref|XP_007792258.1| putative autophagic death protein aut7 idi- protein [Eutypa lata UCREL1] gi|471569203|gb|EMR68645.1| putative autophagic death protein aut7 idi- protein [Eutypa lata UCREL1] Length = 120 Score = 102 bits (255), Expect = 8e-20 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = -1 Query: 321 RIKLSPEKAIFIFVDEVLPPTAALMSCIYEEHKDEDGFLYITYSGENTFGFE 166 RIKLSPEKAIFIFVDEVLPPTAALMS IYEEHKDEDGFLYITYSGENTFG E Sbjct: 67 RIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEE 118