BLASTX nr result
ID: Cornus23_contig00026059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026059 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW79307.1| chloroplast cytochrome b6 [Acetabularia acetabulum] 59 1e-06 ref|XP_009353211.1| PREDICTED: cytochrome b6-f complex iron-sulf... 57 4e-06 ref|XP_008379583.1| PREDICTED: cytochrome b6-f complex iron-sulf... 57 4e-06 ref|XP_011048475.1| PREDICTED: cytochrome b6-f complex iron-sulf... 56 9e-06 ref|XP_002319934.1| PHOTOSYNTHETIC ELECTRON TRANSFER C family pr... 56 9e-06 >gb|AAW79307.1| chloroplast cytochrome b6 [Acetabularia acetabulum] Length = 174 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 441 PLSLALAHCDINDDTVVFTEWKETDFRTGKDP 346 PLSLALAHCDI DD VVF+ W ETDFRTG++P Sbjct: 140 PLSLALAHCDIQDDAVVFSPWTETDFRTGENP 171 >ref|XP_009353211.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Pyrus x bretschneideri] Length = 229 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 441 PLSLALAHCDINDDTVVFTEWKETDFRTGKDP 346 PLSLALAHCDI+D VVF W ETDFRTG+DP Sbjct: 195 PLSLALAHCDIDDGKVVFVPWVETDFRTGEDP 226 >ref|XP_008379583.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Malus domestica] Length = 227 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 441 PLSLALAHCDINDDTVVFTEWKETDFRTGKDP 346 PLSLALAHCDI+D VVF W ETDFRTG+DP Sbjct: 193 PLSLALAHCDIDDGKVVFVPWVETDFRTGEDP 224 >ref|XP_011048475.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Populus euphratica] Length = 228 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 441 PLSLALAHCDINDDTVVFTEWKETDFRTGKDP 346 PLSLALAHCD++D VVF W ETDFRTG DP Sbjct: 194 PLSLALAHCDVDDGKVVFVPWVETDFRTGDDP 225 >ref|XP_002319934.1| PHOTOSYNTHETIC ELECTRON TRANSFER C family protein [Populus trichocarpa] gi|222858310|gb|EEE95857.1| PHOTOSYNTHETIC ELECTRON TRANSFER C family protein [Populus trichocarpa] Length = 228 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 441 PLSLALAHCDINDDTVVFTEWKETDFRTGKDP 346 PLSLALAHCD++D VVF W ETDFRTG DP Sbjct: 194 PLSLALAHCDVDDGKVVFVPWVETDFRTGDDP 225