BLASTX nr result
ID: Cornus23_contig00026008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00026008 (409 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP40831.1| hypothetical protein JCGZ_24830 [Jatropha curcas] 57 5e-06 >gb|KDP40831.1| hypothetical protein JCGZ_24830 [Jatropha curcas] Length = 116 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 4/52 (7%) Frame = -3 Query: 407 ASNPQRSLLVTLMIFMVILSPALPSDAAQITPRELRQ----KPSCPPCLCCQ 264 A+N +S+LVTL IF ++LSPA+PS+AA++ R+L Q P CP C+CC+ Sbjct: 2 AANSLKSVLVTLFIFAMVLSPAIPSEAARLNHRDLLQTTTRPPICPACVCCE 53