BLASTX nr result
ID: Cornus23_contig00025376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00025376 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGW04559.1| hypothetical chloroplast protein [Eustegia minuta] 59 2e-06 gb|AKR80832.1| hypothetical chloroplast RF21 (plastid) [Xerophyt... 56 9e-06 gb|ABQ14858.1| Ycf2 [Kalanchoe daigremontiana] 56 9e-06 >gb|AGW04559.1| hypothetical chloroplast protein [Eustegia minuta] Length = 2320 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -2 Query: 164 QDLFVSWGKNLHELDFLRNESRENWI--*EFSRTRKYISVHKLAANI 30 QDLFVSWGKNLHE DFLRN SRENWI + +R R + V +++NI Sbjct: 346 QDLFVSWGKNLHESDFLRNVSRENWIWLDKVNRDRFFSKVQNVSSNI 392 >gb|AKR80832.1| hypothetical chloroplast RF21 (plastid) [Xerophyta retinervis] Length = 2297 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -2 Query: 167 HQDLFVSWGKNLHELDFLRNESRENWI 87 HQDLFVSWGKN HE DFLRN SRENWI Sbjct: 325 HQDLFVSWGKNQHESDFLRNVSRENWI 351 >gb|ABQ14858.1| Ycf2 [Kalanchoe daigremontiana] Length = 2271 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/51 (56%), Positives = 34/51 (66%), Gaps = 5/51 (9%) Frame = -2 Query: 167 HQDLFVSWGKNLHELDFLRNESRENWI-----*EFSRTRKYISVHKLAANI 30 HQDLFVSWGKN HE DFLRN SRENWI +R R + V +++NI Sbjct: 325 HQDLFVSWGKNPHESDFLRNVSRENWIWLDNVWLVNRDRFFSKVQNVSSNI 375