BLASTX nr result
ID: Cornus23_contig00025256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00025256 (549 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258672.1| PREDICTED: vacuolar protein sorting-associat... 60 6e-07 ref|XP_010258670.1| PREDICTED: vacuolar protein sorting-associat... 60 6e-07 >ref|XP_010258672.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X2 [Nelumbo nucifera] Length = 198 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -2 Query: 548 IASQLSSAPKGQIASRKVDNVVPSFESTDVKDLEK 444 IASQLSSAPKG+IAS+K++NVVPS ESTDV+DLEK Sbjct: 156 IASQLSSAPKGRIASKKIENVVPSSESTDVEDLEK 190 >ref|XP_010258670.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X1 [Nelumbo nucifera] Length = 216 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -2 Query: 548 IASQLSSAPKGQIASRKVDNVVPSFESTDVKDLEK 444 IASQLSSAPKG+IAS+K++NVVPS ESTDV+DLEK Sbjct: 174 IASQLSSAPKGRIASKKIENVVPSSESTDVEDLEK 208