BLASTX nr result
ID: Cornus23_contig00024679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00024679 (290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007677841.1| hypothetical protein BAUCODRAFT_123780 [Baud... 64 3e-08 ref|XP_008023544.1| hypothetical protein SETTUDRAFT_168126 [Seto... 62 1e-07 ref|XP_014556367.1| hypothetical protein COCVIDRAFT_26904 [Bipol... 62 2e-07 ref|XP_007709025.1| hypothetical protein COCCADRAFT_23620 [Bipol... 62 2e-07 ref|XP_014075073.1| hypothetical protein COCC4DRAFT_64690 [Bipol... 62 2e-07 gb|EMD94493.1| hypothetical protein COCHEDRAFT_1131167 [Bipolari... 62 2e-07 ref|XP_007696715.1| hypothetical protein COCSADRAFT_168179 [Bipo... 62 2e-07 ref|XP_011109013.1| hypothetical protein H072_3029 [Dactylellina... 61 4e-07 gb|EMF10887.1| RNA-binding domain-containing protein [Sphaerulin... 59 1e-06 ref|XP_011119468.1| hypothetical protein AOL_s00043g680 [Arthrob... 59 1e-06 ref|XP_007827215.1| hypothetical protein PFICI_00443 [Pestalotio... 59 2e-06 gb|EWC46329.1| hypothetical protein DRE_04500 [Drechslerella ste... 58 2e-06 ref|XP_007929755.1| hypothetical protein MYCFIDRAFT_57804 [Pseud... 58 2e-06 gb|KJY00220.1| hypothetical protein TI39_contig339g00027 [Zymose... 58 3e-06 ref|XP_007777322.1| hypothetical protein W97_01224 [Coniosporium... 58 3e-06 ref|XP_003852648.1| hypothetical protein MYCGRDRAFT_104484 [Zymo... 58 3e-06 gb|KPM38070.1| hypothetical protein AK830_g8475 [Neonectria diti... 57 4e-06 gb|KNG46505.1| glycine-rich rna-binding protein [Stemphylium lyc... 57 4e-06 gb|KIW07611.1| hypothetical protein PV09_01561 [Verruconis gallo... 57 4e-06 ref|XP_003838913.1| hypothetical protein LEMA_P025860.1 [Leptosp... 57 4e-06 >ref|XP_007677841.1| hypothetical protein BAUCODRAFT_123780 [Baudoinia panamericana UAMH 10762] gi|449299310|gb|EMC95324.1| hypothetical protein BAUCODRAFT_123780 [Baudoinia panamericana UAMH 10762] Length = 169 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 95 MGSKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 MGSKLFIGGLAWHTDDQTLR KFEEFG VEE Sbjct: 1 MGSKLFIGGLAWHTDDQTLRAKFEEFGQVEE 31 >ref|XP_008023544.1| hypothetical protein SETTUDRAFT_168126 [Setosphaeria turcica Et28A] gi|482812169|gb|EOA88901.1| hypothetical protein SETTUDRAFT_168126 [Setosphaeria turcica Et28A] Length = 161 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQTLR KFEEFGPVEE Sbjct: 2 SKLFIGGLAWHTDDQTLRQKFEEFGPVEE 30 >ref|XP_014556367.1| hypothetical protein COCVIDRAFT_26904 [Bipolaris victoriae FI3] gi|578489356|gb|EUN26788.1| hypothetical protein COCVIDRAFT_26904 [Bipolaris victoriae FI3] Length = 166 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 +KLFIGGLAWHTDDQTLR KFEEFGPVEE Sbjct: 2 AKLFIGGLAWHTDDQTLRSKFEEFGPVEE 30 >ref|XP_007709025.1| hypothetical protein COCCADRAFT_23620 [Bipolaris zeicola 26-R-13] gi|576922557|gb|EUC36684.1| hypothetical protein COCCADRAFT_23620 [Bipolaris zeicola 26-R-13] Length = 164 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 +KLFIGGLAWHTDDQTLR KFEEFGPVEE Sbjct: 2 AKLFIGGLAWHTDDQTLRSKFEEFGPVEE 30 >ref|XP_014075073.1| hypothetical protein COCC4DRAFT_64690 [Bipolaris maydis ATCC 48331] gi|477584070|gb|ENI01164.1| hypothetical protein COCC4DRAFT_64690 [Bipolaris maydis ATCC 48331] Length = 150 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 +KLFIGGLAWHTDDQTLR KFEEFGPVEE Sbjct: 2 AKLFIGGLAWHTDDQTLRSKFEEFGPVEE 30 >gb|EMD94493.1| hypothetical protein COCHEDRAFT_1131167 [Bipolaris maydis C5] Length = 125 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 +KLFIGGLAWHTDDQTLR KFEEFGPVEE Sbjct: 2 AKLFIGGLAWHTDDQTLRSKFEEFGPVEE 30 >ref|XP_007696715.1| hypothetical protein COCSADRAFT_168179 [Bipolaris sorokiniana ND90Pr] gi|451853629|gb|EMD66922.1| hypothetical protein COCSADRAFT_168179 [Bipolaris sorokiniana ND90Pr] Length = 159 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 +KLFIGGLAWHTDDQTLR KFEEFGPVEE Sbjct: 2 AKLFIGGLAWHTDDQTLRSKFEEFGPVEE 30 >ref|XP_011109013.1| hypothetical protein H072_3029 [Dactylellina haptotyla CBS 200.50] gi|526202621|gb|EPS42954.1| hypothetical protein H072_3029 [Dactylellina haptotyla CBS 200.50] Length = 163 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLF+GGLAWHTDD TLR KFEEFGPVEE Sbjct: 2 SKLFVGGLAWHTDDDTLRAKFEEFGPVEE 30 >gb|EMF10887.1| RNA-binding domain-containing protein [Sphaerulina musiva SO2202] Length = 178 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQTLR KFEEFG V+E Sbjct: 2 SKLFIGGLAWHTDDQTLRAKFEEFGQVDE 30 >ref|XP_011119468.1| hypothetical protein AOL_s00043g680 [Arthrobotrys oligospora ATCC 24927] gi|345569077|gb|EGX51946.1| hypothetical protein AOL_s00043g680 [Arthrobotrys oligospora ATCC 24927] Length = 150 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLF+GGLAWHTDDQTLR KFEEFG VEE Sbjct: 2 SKLFVGGLAWHTDDQTLRTKFEEFGQVEE 30 >ref|XP_007827215.1| hypothetical protein PFICI_00443 [Pestalotiopsis fici W106-1] gi|573067087|gb|ETS86615.1| hypothetical protein PFICI_00443 [Pestalotiopsis fici W106-1] Length = 170 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHT+D TLR KFEEFGPVEE Sbjct: 2 SKLFIGGLAWHTEDATLRQKFEEFGPVEE 30 >gb|EWC46329.1| hypothetical protein DRE_04500 [Drechslerella stenobrocha 248] Length = 129 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLF+GGLAWHTDDQTLR KFEEFG VEE Sbjct: 2 SKLFVGGLAWHTDDQTLRQKFEEFGIVEE 30 >ref|XP_007929755.1| hypothetical protein MYCFIDRAFT_57804 [Pseudocercospora fijiensis CIRAD86] gi|452979373|gb|EME79135.1| hypothetical protein MYCFIDRAFT_57804 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQTLR KFEEFG V+E Sbjct: 2 SKLFIGGLAWHTDDQTLRTKFEEFGQVDE 30 >gb|KJY00220.1| hypothetical protein TI39_contig339g00027 [Zymoseptoria brevis] Length = 183 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQTLR KFEE+G V+E Sbjct: 2 SKLFIGGLAWHTDDQTLRAKFEEYGQVDE 30 >ref|XP_007777322.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] gi|494824751|gb|EON62005.1| hypothetical protein W97_01224 [Coniosporium apollinis CBS 100218] Length = 172 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDD TLR KFEEFG VEE Sbjct: 2 SKLFIGGLAWHTDDTTLRAKFEEFGQVEE 30 >ref|XP_003852648.1| hypothetical protein MYCGRDRAFT_104484 [Zymoseptoria tritici IPO323] gi|339472529|gb|EGP87624.1| hypothetical protein MYCGRDRAFT_104484 [Zymoseptoria tritici IPO323] Length = 184 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQTLR KFEE+G V+E Sbjct: 2 SKLFIGGLAWHTDDQTLRAKFEEYGQVDE 30 >gb|KPM38070.1| hypothetical protein AK830_g8475 [Neonectria ditissima] Length = 182 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHT++ TLR KFEEFGPVEE Sbjct: 2 SKLFIGGLAWHTEENTLRQKFEEFGPVEE 30 >gb|KNG46505.1| glycine-rich rna-binding protein [Stemphylium lycopersici] Length = 163 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQ LR KFEEFG VEE Sbjct: 2 SKLFIGGLAWHTDDQALRQKFEEFGQVEE 30 >gb|KIW07611.1| hypothetical protein PV09_01561 [Verruconis gallopava] Length = 168 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDD TLR KFEEFG VEE Sbjct: 2 SKLFIGGLAWHTDDSTLRTKFEEFGQVEE 30 >ref|XP_003838913.1| hypothetical protein LEMA_P025860.1 [Leptosphaeria maculans JN3] gi|312215482|emb|CBX95434.1| hypothetical protein LEMA_P025860.1 [Leptosphaeria maculans JN3] Length = 164 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -1 Query: 89 SKLFIGGLAWHTDDQTLRGKFEEFGPVEE 3 SKLFIGGLAWHTDDQ LR KFEEFG VEE Sbjct: 2 SKLFIGGLAWHTDDQALRQKFEEFGQVEE 30