BLASTX nr result
ID: Cornus23_contig00024608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00024608 (617 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008800820.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-rela... 66 2e-08 ref|XP_008674361.1| PREDICTED: auxilin-related protein 1-like [Z... 66 2e-08 ref|XP_002321224.1| auxilin-related family protein [Populus tric... 65 2e-08 ref|XP_006375591.1| hypothetical protein POPTR_0014s17160g [Popu... 65 2e-08 ref|XP_006388133.1| hypothetical protein POPTR_0319s00220g [Popu... 65 2e-08 ref|NP_001042996.1| Os01g0355500 [Oryza sativa Japonica Group] g... 64 5e-08 ref|XP_010931651.1| PREDICTED: auxilin-related protein 2-like is... 64 5e-08 ref|XP_010914449.1| PREDICTED: auxilin-related protein 2-like is... 64 5e-08 ref|XP_010524634.1| PREDICTED: auxilin-related protein 2-like [T... 64 5e-08 ref|XP_010270274.1| PREDICTED: auxilin-related protein 2-like [N... 64 5e-08 ref|XP_010269037.1| PREDICTED: auxilin-related protein 2 [Nelumb... 64 5e-08 ref|XP_009799251.1| PREDICTED: auxilin-related protein 2-like [N... 64 5e-08 ref|XP_009364182.1| PREDICTED: auxilin-related protein 2-like [P... 64 5e-08 ref|XP_008807324.1| PREDICTED: auxilin-related protein 2-like [P... 64 5e-08 ref|XP_008662610.1| PREDICTED: auxilin-related protein 1-like [Z... 64 5e-08 ref|XP_008366724.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-rela... 64 5e-08 ref|XP_008365846.1| PREDICTED: auxilin-related protein 1-like [M... 64 5e-08 ref|XP_008394184.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-rela... 64 5e-08 ref|XP_008227521.1| PREDICTED: auxilin-related protein 1-like [P... 64 5e-08 gb|KDO51042.1| hypothetical protein CISIN_1g002109mg [Citrus sin... 64 5e-08 >ref|XP_008800820.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 2-like [Phoenix dactylifera] Length = 949 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF Sbjct: 919 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 949 >ref|XP_008674361.1| PREDICTED: auxilin-related protein 1-like [Zea mays] Length = 884 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF Sbjct: 854 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 884 >ref|XP_002321224.1| auxilin-related family protein [Populus trichocarpa] gi|222861997|gb|EEE99539.1| auxilin-related family protein [Populus trichocarpa] Length = 941 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKY+AEKVFDLLKEAWNKLNSEELF Sbjct: 911 KGANLQQKYVAEKVFDLLKEAWNKLNSEELF 941 >ref|XP_006375591.1| hypothetical protein POPTR_0014s17160g [Populus trichocarpa] gi|550324387|gb|ERP53388.1| hypothetical protein POPTR_0014s17160g [Populus trichocarpa] Length = 998 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKY+AEKVFDLLKEAWNKLNSEELF Sbjct: 968 KGANLQQKYVAEKVFDLLKEAWNKLNSEELF 998 >ref|XP_006388133.1| hypothetical protein POPTR_0319s00220g [Populus trichocarpa] gi|566256347|ref|XP_006388134.1| hypothetical protein POPTR_0319s00220g [Populus trichocarpa] gi|550309556|gb|ERP47047.1| hypothetical protein POPTR_0319s00220g [Populus trichocarpa] gi|550309557|gb|ERP47048.1| hypothetical protein POPTR_0319s00220g [Populus trichocarpa] Length = 98 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKY+AEKVFDLLKEAWNKLNSEELF Sbjct: 68 KGANLQQKYVAEKVFDLLKEAWNKLNSEELF 98 >ref|NP_001042996.1| Os01g0355500 [Oryza sativa Japonica Group] gi|53791356|dbj|BAD52602.1| 200 kDa antigen p200 -like protein [Oryza sativa Japonica Group] gi|53792120|dbj|BAD52753.1| 200 kDa antigen p200 -like protein [Oryza sativa Japonica Group] gi|113532527|dbj|BAF04910.1| Os01g0355500 [Oryza sativa Japonica Group] gi|215713411|dbj|BAG94548.1| unnamed protein product [Oryza sativa Japonica Group] gi|937896081|dbj|BAS72061.1| Os01g0355500 [Oryza sativa Japonica Group] Length = 948 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 918 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 948 >ref|XP_010931651.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Elaeis guineensis] Length = 940 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 910 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 940 >ref|XP_010914449.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Elaeis guineensis] Length = 927 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 897 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 927 >ref|XP_010524634.1| PREDICTED: auxilin-related protein 2-like [Tarenaya hassleriana] Length = 900 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 870 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 900 >ref|XP_010270274.1| PREDICTED: auxilin-related protein 2-like [Nelumbo nucifera] Length = 968 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 938 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 968 >ref|XP_010269037.1| PREDICTED: auxilin-related protein 2 [Nelumbo nucifera] Length = 1000 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 970 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 1000 >ref|XP_009799251.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris] gi|698507900|ref|XP_009799252.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris] gi|698507902|ref|XP_009799253.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris] Length = 959 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 929 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 959 >ref|XP_009364182.1| PREDICTED: auxilin-related protein 2-like [Pyrus x bretschneideri] Length = 977 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 947 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 977 >ref|XP_008807324.1| PREDICTED: auxilin-related protein 2-like [Phoenix dactylifera] Length = 930 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 900 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 930 >ref|XP_008662610.1| PREDICTED: auxilin-related protein 1-like [Zea mays] Length = 884 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 854 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 884 >ref|XP_008366724.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 1-like [Malus domestica] Length = 122 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 80 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 110 >ref|XP_008365846.1| PREDICTED: auxilin-related protein 1-like [Malus domestica] Length = 973 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 943 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 973 >ref|XP_008394184.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 2-like [Malus domestica] Length = 991 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 949 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 979 >ref|XP_008227521.1| PREDICTED: auxilin-related protein 1-like [Prunus mume] Length = 983 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 953 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 983 >gb|KDO51042.1| hypothetical protein CISIN_1g002109mg [Citrus sinensis] Length = 914 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 617 KGANLQQKYIAEKVFDLLKEAWNKLNSEELF 525 KGANLQQKYIAEKVFDLLKEAWNK NSEELF Sbjct: 884 KGANLQQKYIAEKVFDLLKEAWNKFNSEELF 914