BLASTX nr result
ID: Cornus23_contig00024506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00024506 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009799908.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 82 2e-13 ref|XP_009594133.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 82 2e-13 emb|CDP00314.1| unnamed protein product [Coffea canephora] 80 8e-13 ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 79 1e-12 ref|XP_011069702.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 75 2e-11 ref|XP_003593884.2| dopamine beta-monooxygenase, putative [Medic... 75 2e-11 gb|KGN55439.1| hypothetical protein Csa_4G652040 [Cucumis sativus] 75 2e-11 ref|XP_004145587.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 75 2e-11 ref|XP_008452861.1| PREDICTED: uncharacterized protein LOC103493... 74 4e-11 ref|XP_010322736.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 71 4e-10 ref|XP_004485991.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 71 4e-10 ref|XP_007224055.1| hypothetical protein PRUPE_ppa015250mg [Prun... 71 4e-10 ref|XP_014510414.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 70 6e-10 ref|XP_014510413.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 70 6e-10 gb|KOM30777.1| hypothetical protein LR48_Vigan01g033200 [Vigna a... 70 6e-10 ref|XP_002515444.1| dopamine beta-monooxygenase, putative [Ricin... 70 6e-10 ref|XP_011036658.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 69 1e-09 ref|XP_009363850.1| PREDICTED: uncharacterized protein LOC103953... 69 1e-09 ref|XP_008377667.1| PREDICTED: uncharacterized protein LOC103440... 69 1e-09 ref|XP_008220693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 69 1e-09 >ref|XP_009799908.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana sylvestris] Length = 900 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ RRR+RI GRSNWVLG+GE+EDIDLLSP++ A K+S S+RMEVQLEP+SR Sbjct: 847 ERKRRRDRISGRSNWVLGSGEEEDIDLLSPSQAMAEKDSRSSDRMEVQLEPISR 900 >ref|XP_009594133.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana tomentosiformis] Length = 901 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ RRR+RI GRSNWVLG+GE+EDIDLLSP++ A K+S S+RMEVQLEP+SR Sbjct: 848 ERKRRRDRISGRSNWVLGSGEEEDIDLLSPSQAMAEKDSRSSDRMEVQLEPISR 901 >emb|CDP00314.1| unnamed protein product [Coffea canephora] Length = 844 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 EK RR++RI G S+WVLGNGE+ED+DLLSP+R A K+S SERMEVQLEPLSR Sbjct: 791 EKKRRQDRISGGSSWVLGNGEEEDVDLLSPSRTVAEKDSDFSERMEVQLEPLSR 844 >ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Erythranthe guttatus] gi|604321873|gb|EYU32377.1| hypothetical protein MIMGU_mgv1a001118mg [Erythranthe guttata] Length = 883 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E + R R+ GRSNWVLGNGE+EDIDLL +RP KES+ SERMEVQLEPLSR Sbjct: 830 ETSMSRGRVAGRSNWVLGNGEEEDIDLLRQSRPMTDKESYSSERMEVQLEPLSR 883 >ref|XP_011069702.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Sesamum indicum] Length = 883 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/54 (70%), Positives = 42/54 (77%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E +RR RI GRSNWVLGNGE+ED+DLLS +R KES SERMEVQLE LSR Sbjct: 830 EMKKRRGRILGRSNWVLGNGEEEDVDLLSRSRVRTEKESQSSERMEVQLEALSR 883 >ref|XP_003593884.2| dopamine beta-monooxygenase, putative [Medicago truncatula] gi|657396810|gb|AES64135.2| dopamine beta-monooxygenase, putative [Medicago truncatula] Length = 894 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFA-GKESHPSERMEVQLEPLSR 145 EK + R+RIFGR NWVLGN ED+ IDLLSPT P + KES S RMEVQLEPL+R Sbjct: 840 EKQQARDRIFGRGNWVLGNEEDDSIDLLSPTIPLSTNKESQASARMEVQLEPLNR 894 >gb|KGN55439.1| hypothetical protein Csa_4G652040 [Cucumis sativus] Length = 856 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ RRR+R GRSNWVLGN ED +DLL PT GKESHPS MEVQLEPL R Sbjct: 804 ERQRRRDRAIGRSNWVLGNDEDS-VDLLGPTISIEGKESHPSRTMEVQLEPLRR 856 >ref|XP_004145587.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Cucumis sativus] Length = 898 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ RRR+R GRSNWVLGN ED +DLL PT GKESHPS MEVQLEPL R Sbjct: 846 ERQRRRDRAIGRSNWVLGNDEDS-VDLLGPTISIEGKESHPSRTMEVQLEPLRR 898 >ref|XP_008452861.1| PREDICTED: uncharacterized protein LOC103493759 [Cucumis melo] Length = 898 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ RRR+R GRSNWVLGN ED +DLL PT GKESHPS MEVQLEPL R Sbjct: 846 ERQRRRDRTIGRSNWVLGNDEDS-VDLLGPTISIEGKESHPSGTMEVQLEPLRR 898 >ref|XP_010322736.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Solanum lycopersicum] Length = 901 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ +RR+RI GRSNWVLG+GE+ED DLLSP++ A K++ ++ MEVQLEP+ R Sbjct: 848 ERKKRRDRISGRSNWVLGSGEEEDTDLLSPSQAMAEKDAASADCMEVQLEPMGR 901 >ref|XP_004485991.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Cicer arietinum] Length = 900 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/55 (65%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDEDIDLLSPTRPF-AGKESHPSERMEVQLEPLSR 145 EK R R+RIFGR NWVLGN ED+ +DLL+PT KES S RMEVQLEPL+R Sbjct: 846 EKQRVRDRIFGRGNWVLGNEEDDSLDLLTPTNTHTTDKESQASARMEVQLEPLNR 900 >ref|XP_007224055.1| hypothetical protein PRUPE_ppa015250mg [Prunus persica] gi|462420991|gb|EMJ25254.1| hypothetical protein PRUPE_ppa015250mg [Prunus persica] Length = 904 Score = 70.9 bits (172), Expect = 4e-10 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 EK +RR+R FGRSNWVLGN E++D +DLLSP A KES S RMEVQLEPL+R Sbjct: 850 EKQQRRDRSFGRSNWVLGNLEEDDSVDLLSPNGVHAEKESQTSGRMEVQLEPLNR 904 >ref|XP_014510414.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X2 [Vigna radiata var. radiata] Length = 841 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ R R +I RSNWVLGN ED+D +DLLSPTR A KE PS RMEVQLEPL+R Sbjct: 787 ERQRIRRQILERSNWVLGNVEDDDSLDLLSPTRTTANKELLPSSRMEVQLEPLNR 841 >ref|XP_014510413.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X1 [Vigna radiata var. radiata] Length = 878 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ R R +I RSNWVLGN ED+D +DLLSPTR A KE PS RMEVQLEPL+R Sbjct: 824 ERQRIRRQILERSNWVLGNVEDDDSLDLLSPTRTTANKELLPSSRMEVQLEPLNR 878 >gb|KOM30777.1| hypothetical protein LR48_Vigan01g033200 [Vigna angularis] Length = 878 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 E+ R R +I RSNWVLGN ED+D +DLLSPTR A KE PS RMEVQLEPL+R Sbjct: 824 ERQRIRRQILERSNWVLGNVEDDDSLDLLSPTRTTANKELLPSSRMEVQLEPLNR 878 >ref|XP_002515444.1| dopamine beta-monooxygenase, putative [Ricinus communis] gi|223545388|gb|EEF46893.1| dopamine beta-monooxygenase, putative [Ricinus communis] Length = 814 Score = 70.1 bits (170), Expect = 6e-10 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 EK RRR+R FGRSNWVLGN E+ED IDLLSP+R A +E + RMEVQLE L+R Sbjct: 760 EKQRRRDRTFGRSNWVLGNFEEEDSIDLLSPSRAAAQRELQQAGRMEVQLEALNR 814 >ref|XP_011036658.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Populus euphratica] Length = 900 Score = 69.3 bits (168), Expect = 1e-09 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 EK RR RI GRSNWVLGN E+ED IDLLSP R A K++ S RMEVQLEP++R Sbjct: 846 EKQRRSGRILGRSNWVLGNLEEEDSIDLLSPARASAQKDAQHSGRMEVQLEPMNR 900 >ref|XP_009363850.1| PREDICTED: uncharacterized protein LOC103953776 [Pyrus x bretschneideri] Length = 906 Score = 69.3 bits (168), Expect = 1e-09 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 EK +RR+R FGRSNWVLGN E++D +DLLSP + KES S RMEVQLEPL+R Sbjct: 852 EKQQRRDRSFGRSNWVLGNLEEDDSVDLLSPNGIHSEKESQSSGRMEVQLEPLNR 906 >ref|XP_008377667.1| PREDICTED: uncharacterized protein LOC103440746 [Malus domestica] Length = 909 Score = 69.3 bits (168), Expect = 1e-09 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLSR 145 EK +RR+R FGRSNWVLGN E++D +DLLSP + KES S RMEVQLEPL+R Sbjct: 855 EKQQRRDRSFGRSNWVLGNLEEDDSVDLLSPNGIHSEKESQTSGRMEVQLEPLNR 909 >ref|XP_008220693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103320752 [Prunus mume] Length = 897 Score = 68.9 bits (167), Expect = 1e-09 Identities = 36/54 (66%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -1 Query: 306 EKTRRRERIFGRSNWVLGNGEDED-IDLLSPTRPFAGKESHPSERMEVQLEPLS 148 EK +RR+R FGRSNWVLGN E++D +DLLSP A KES S RMEVQLEPL+ Sbjct: 841 EKQQRRDRSFGRSNWVLGNLEEDDSVDLLSPNGVHAEKESQTSGRMEVQLEPLN 894