BLASTX nr result
ID: Cornus23_contig00024257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00024257 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514524.1| conserved hypothetical protein [Ricinus comm... 65 2e-08 emb|CAN69191.1| hypothetical protein VITISV_001579 [Vitis vinifera] 62 1e-07 ref|XP_010111097.1| hypothetical protein L484_002648 [Morus nota... 60 5e-07 >ref|XP_002514524.1| conserved hypothetical protein [Ricinus communis] gi|223546128|gb|EEF47630.1| conserved hypothetical protein [Ricinus communis] Length = 189 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = +1 Query: 118 TTRHAIFAFIVPIIINFLELMYQGKDKSPFETHPKSMRVGIVSLLIYGFAYDAKSRFSS 294 T+ HAI AF+VP++++F+E+ QG KSPFETHP + + I SLL Y AY + F S Sbjct: 42 TSLHAILAFVVPVLLDFIEIKCQGSSKSPFETHPVTTQFAIASLLAYSIAYGIELAFPS 100 >emb|CAN69191.1| hypothetical protein VITISV_001579 [Vitis vinifera] Length = 188 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/69 (42%), Positives = 43/69 (62%) Frame = +1 Query: 91 FFSEGPCMPTTRHAIFAFIVPIIINFLELMYQGKDKSPFETHPKSMRVGIVSLLIYGFAY 270 + +G P + HA+ AFI+P+++ FL L Y K +PFETHPK+M+ I SLL+Y AY Sbjct: 26 YLLQGRLSPNSCHAVLAFILPLLVAFLALKYVEKVATPFETHPKTMQFAIGSLLVYCLAY 85 Query: 271 DAKSRFSST 297 + S+ Sbjct: 86 GTQLSVQSS 94 >ref|XP_010111097.1| hypothetical protein L484_002648 [Morus notabilis] gi|587943610|gb|EXC30126.1| hypothetical protein L484_002648 [Morus notabilis] Length = 191 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/89 (38%), Positives = 50/89 (56%) Frame = +1 Query: 25 SLPRIRSNFTGQFNVAFIAMRYFFSEGPCMPTTRHAIFAFIVPIIINFLELMYQGKDKSP 204 SLP + +F +N+ I YF + +P H I AFI+P+I++ +EL Q K SP Sbjct: 18 SLPHEQPSFNIVYNMPTI--NYFQPQHRIIPNFPHPIVAFIIPVILHLIELQCQCKANSP 75 Query: 205 FETHPKSMRVGIVSLLIYGFAYDAKSRFS 291 FET+P +M G+ LL Y AY + R + Sbjct: 76 FETNPVTMWFGVSCLLAYCLAYGIELRIA 104