BLASTX nr result
ID: Cornus23_contig00023210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00023210 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096057.1| hypothetical protein L484_008713 [Morus nota... 59 1e-06 ref|XP_010096055.1| hypothetical protein L484_008711 [Morus nota... 58 3e-06 >ref|XP_010096057.1| hypothetical protein L484_008713 [Morus notabilis] gi|587873687|gb|EXB62863.1| hypothetical protein L484_008713 [Morus notabilis] Length = 242 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 2/92 (2%) Frame = +1 Query: 55 LPPSWSLRCAQSHERPASRPSDGSLYLHQAAFDAFLYFPFPRFVRELLVDLNLSPGQLTP 234 +P LR + P S P G + L+ AF+ L PF F+R +L +L+P QL+P Sbjct: 32 IPAGVRLRIPSVGDLP-SCPKPGEIGLYTVAFEYGLRLPFHPFIRTVLAHFDLAPTQLSP 90 Query: 235 NAWKCVTGCMVLWYLCGNPP--LTLREFYYLF 324 N W+ + G ++LW +C +TL EF + + Sbjct: 91 NVWRHMAGAIILWRICSEEKDHITLDEFNFCY 122 >ref|XP_010096055.1| hypothetical protein L484_008711 [Morus notabilis] gi|587873685|gb|EXB62861.1| hypothetical protein L484_008711 [Morus notabilis] Length = 160 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 2/92 (2%) Frame = +1 Query: 55 LPPSWSLRCAQSHERPASRPSDGSLYLHQAAFDAFLYFPFPRFVRELLVDLNLSPGQLTP 234 +P LR + + P S+P+ G + LH AF+ L PF F R +L L+P QL+ Sbjct: 30 IPAGVRLRIPSAVDLP-SQPNRGEICLHMLAFECGLRLPFHPFFRTVLAHFGLAPTQLSL 88 Query: 235 NAWKCVTGCMVLWYLCGNPP--LTLREFYYLF 324 N W + G ++LW +C +TL EF + + Sbjct: 89 NVWMHMAGAVILWRICSEEKDHITLDEFNFCY 120