BLASTX nr result
ID: Cornus23_contig00023199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00023199 (269 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRG92655.1| hypothetical protein GLYMA_20G224000 [Glycine max] 62 2e-07 ref|XP_003556463.2| PREDICTED: trihelix transcription factor GTL... 62 2e-07 ref|XP_012089242.1| PREDICTED: trihelix transcription factor GTL... 61 3e-07 gb|KOM52952.1| hypothetical protein LR48_Vigan09g161100 [Vigna a... 56 9e-06 ref|XP_002512226.1| transcription factor, putative [Ricinus comm... 56 9e-06 >gb|KRG92655.1| hypothetical protein GLYMA_20G224000 [Glycine max] Length = 671 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = -3 Query: 258 KEEHTHIHTTTNMFDGVPDQFHQFIASRTSLPLPLSFPLHGS 133 K E +T TNMFDGVPDQFHQFI RTSLPL L FPLH S Sbjct: 70 KREVVTQNTNTNMFDGVPDQFHQFITPRTSLPLHLPFPLHTS 111 >ref|XP_003556463.2| PREDICTED: trihelix transcription factor GTL2-like [Glycine max] gi|947042932|gb|KRG92656.1| hypothetical protein GLYMA_20G224000 [Glycine max] Length = 643 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = -3 Query: 258 KEEHTHIHTTTNMFDGVPDQFHQFIASRTSLPLPLSFPLHGS 133 K E +T TNMFDGVPDQFHQFI RTSLPL L FPLH S Sbjct: 42 KREVVTQNTNTNMFDGVPDQFHQFITPRTSLPLHLPFPLHTS 83 >ref|XP_012089242.1| PREDICTED: trihelix transcription factor GTL2 [Jatropha curcas] gi|643708732|gb|KDP23648.1| hypothetical protein JCGZ_23481 [Jatropha curcas] Length = 602 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/32 (90%), Positives = 31/32 (96%), Gaps = 1/32 (3%) Frame = -3 Query: 222 MFDGVPDQFHQFIASRTSLPLPLSF-PLHGSS 130 MF+GVPDQFHQFIASRTSLPLPLSF P+HGSS Sbjct: 1 MFEGVPDQFHQFIASRTSLPLPLSFQPIHGSS 32 >gb|KOM52952.1| hypothetical protein LR48_Vigan09g161100 [Vigna angularis] Length = 582 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 222 MFDGVPDQFHQFIASRTSLPLPLSFPLHGSS 130 MFDGV DQFHQFIA RT+LPL LSFPLH SS Sbjct: 1 MFDGVSDQFHQFIAPRTTLPLHLSFPLHASS 31 >ref|XP_002512226.1| transcription factor, putative [Ricinus communis] gi|223548187|gb|EEF49678.1| transcription factor, putative [Ricinus communis] Length = 634 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/33 (87%), Positives = 31/33 (93%), Gaps = 2/33 (6%) Frame = -3 Query: 222 MFDGVPDQFHQFIASRT-SLPLPLSF-PLHGSS 130 MF+GVPDQFHQFIASRT SLPLP+SF PLHGSS Sbjct: 1 MFEGVPDQFHQFIASRTSSLPLPVSFPPLHGSS 33