BLASTX nr result
ID: Cornus23_contig00023025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00023025 (374 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010104337.1| hypothetical protein L484_023288 [Morus nota... 67 4e-09 >ref|XP_010104337.1| hypothetical protein L484_023288 [Morus notabilis] gi|587911917|gb|EXB99757.1| hypothetical protein L484_023288 [Morus notabilis] Length = 221 Score = 67.4 bits (163), Expect = 4e-09 Identities = 36/72 (50%), Positives = 44/72 (61%) Frame = -3 Query: 216 MAIKMPSSVYSVNVELPAPSCCRSRSLTWGLADCIHETAFAFGKGLHSQLHFFHGAQPSL 37 MA + SS N LP+P C S + T+ LA C+HET AF SQ FFH +PSL Sbjct: 1 MATTVVSSNCPRNAILPSPKCVGSGAPTFNLATCLHETVSAFSWKHSSQRGFFHVTRPSL 60 Query: 36 ANNSKKLAWSIR 1 ANN KK++WSIR Sbjct: 61 ANNVKKMSWSIR 72