BLASTX nr result
ID: Cornus23_contig00022960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022960 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521724.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 >ref|XP_002521724.1| conserved hypothetical protein [Ricinus communis] gi|223539115|gb|EEF40711.1| conserved hypothetical protein [Ricinus communis] Length = 1137 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -1 Query: 214 FYDVDEVSNDLKKPFLQSCSSRRTLPPDGASFSRDEGFEFQTDGFRAKRMR 62 F D EV+ +KPFL+SCSSR LP DG+ FS ++G EF DGF+ KR R Sbjct: 438 FDDELEVTKMNEKPFLRSCSSRGNLPLDGSLFSSEDGLEFPVDGFKTKRRR 488