BLASTX nr result
ID: Cornus23_contig00022945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022945 (423 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69962.1| hypothetical protein VITISV_008740 [Vitis vinifera] 57 4e-06 >emb|CAN69962.1| hypothetical protein VITISV_008740 [Vitis vinifera] Length = 809 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = -3 Query: 409 KGL-IGKDVDVVWLLNCTKKNFETSLLTKYKEIAPDVIRAYEGEIGFHGFNTRL 251 KGL + K+ DVVW+LN KK FET L +K+ AP+VI+AY+ +G GFN L Sbjct: 748 KGLKVKKNFDVVWILNLDKKTFETKFLIPFKDDAPEVIKAYQEGMGLQGFNDGL 801