BLASTX nr result
ID: Cornus23_contig00022820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022820 (534 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ35422.1| putative dna mismatch repair protein msh6 [Erysip... 72 2e-10 gb|KIN02401.1| hypothetical protein OIDMADRAFT_162578 [Oidiodend... 60 6e-07 >gb|KHJ35422.1| putative dna mismatch repair protein msh6 [Erysiphe necator] Length = 1201 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 533 ESLENTKSCCYLPLGLRSDVSWALKDVSNAEAISDRSLQLLLRAIESL 390 ESLEN KS CYLPLG+RSDVSWALK SN E IS+R L++LLRAI +L Sbjct: 1154 ESLENAKSGCYLPLGIRSDVSWALKHASNKEEISERGLEVLLRAIGNL 1201 >gb|KIN02401.1| hypothetical protein OIDMADRAFT_162578 [Oidiodendron maius Zn] Length = 1208 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -2 Query: 533 ESLENTKSCCYLPLGLRSDVSWALKDVSNAEAISDRSLQLLLRAIESL 390 ESLE +S CY+PLG++SDVSW L++ AE + +R L ++++AIESL Sbjct: 1161 ESLEKARSGCYIPLGMQSDVSWVLREALGAEGVRERDLHVMMKAIESL 1208