BLASTX nr result
ID: Cornus23_contig00022812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022812 (268 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010661831.1| PREDICTED: mechanosensitive ion channel prot... 59 1e-06 >ref|XP_010661831.1| PREDICTED: mechanosensitive ion channel protein 1, mitochondrial [Vitis vinifera] Length = 540 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/82 (41%), Positives = 47/82 (57%) Frame = +2 Query: 11 MAASRFSIWKSRFSTLNRSFKAQSCRSFDSCMKSAKCAGLIDARPSFAYINRNYHAKQSG 190 MA RF I KS ++ K S RS+DSC+ AK A ++ + S+A NR+ H K+S Sbjct: 1 MAGIRFPILKSLCDPIS---KTHSFRSYDSCLDFAKYAYQVELKSSYASSNRSNHTKESP 57 Query: 191 FTQNNVNSGFRVRGLESVVDNQ 256 F N VN+ FR+ + S VD Q Sbjct: 58 FAANFVNARFRIPSIASPVDTQ 79