BLASTX nr result
ID: Cornus23_contig00022795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022795 (256 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW73320.1| hypothetical protein EUGRSUZ_E01777, partial [Euc... 59 2e-06 ref|XP_002270910.1| PREDICTED: uncharacterized protein LOC100249... 56 9e-06 >gb|KCW73320.1| hypothetical protein EUGRSUZ_E01777, partial [Eucalyptus grandis] Length = 215 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 118 EPLGDGELDLHHLRPELLQIDGSALVAIELVEDGVVE 8 E +GDGE DL HLRPELLQ+DG+A VA+E +EDGVVE Sbjct: 86 EAVGDGEHDLPHLRPELLQVDGAAAVAVEALEDGVVE 122 >ref|XP_002270910.1| PREDICTED: uncharacterized protein LOC100249460 [Vitis vinifera] Length = 139 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +2 Query: 2 TLLYDSIFDKFNCDQSRTVDL*EFRSEMMKIKFTIAKG 115 T LYDSIFDKF+CD S TVDL EFRSEM KI IA G Sbjct: 71 TQLYDSIFDKFDCDHSDTVDLEEFRSEMKKIMLAIADG 108