BLASTX nr result
ID: Cornus23_contig00022770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022770 (618 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005851221.1| hypothetical protein CHLNCDRAFT_49959 [Chlor... 50 3e-08 >ref|XP_005851221.1| hypothetical protein CHLNCDRAFT_49959 [Chlorella variabilis] gi|307110884|gb|EFN59119.1| hypothetical protein CHLNCDRAFT_49959 [Chlorella variabilis] Length = 290 Score = 50.4 bits (119), Expect(2) = 3e-08 Identities = 23/58 (39%), Positives = 35/58 (60%) Frame = -3 Query: 370 GNSILDAARQDSDLSVFYRAAANAGLNDTLTSSTVQATVFAPTNDAFDDFLGRLRLDQ 197 G S+LD +D++ +RA AG DTL ++ ATVFAP N AF++ L ++ +Q Sbjct: 79 GESVLDLLAHRADMTTLFRAVVAAGFADTLADESLVATVFAPNNTAFENLLAKVLTNQ 136 Score = 34.7 bits (78), Expect(2) = 3e-08 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -1 Query: 159 VLQYHVIPSSALRASQLSDNQKLTTALNNYRVTV 58 +L YHV+P AL A+QL++ + LTT L V V Sbjct: 151 LLSYHVVPEEALEAAQLTNGRNLTTLLEEEFVEV 184