BLASTX nr result
ID: Cornus23_contig00022733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022733 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIV80317.1| hypothetical protein PV11_07827 [Exophiala sideris] 59 1e-06 >gb|KIV80317.1| hypothetical protein PV11_07827 [Exophiala sideris] Length = 227 Score = 58.9 bits (141), Expect = 1e-06 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 3/74 (4%) Frame = -2 Query: 277 MMIKTVLTIVLAVLHLSPAVQGAPNAALERR--GVCDSGIYAELAPILAGYSIAQAYCTQ 104 M + VL + L VL+ ALE R GVC SGIY ELAPILA Y IA+A+C+ Sbjct: 1 MYPRFVLALTLVVLNYPVVNVATYFPALEPRTGGVCGSGIYGELAPILAAYPIAEAFCSA 60 Query: 103 VYPL-RCPVKAQKR 65 VYP+ R KA KR Sbjct: 61 VYPVKRTTAKAVKR 74