BLASTX nr result
ID: Cornus23_contig00022663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022663 (351 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM83341.1| hypothetical protein ANO11243_013280 [fungal sp.... 127 3e-27 >dbj|GAM83341.1| hypothetical protein ANO11243_013280 [fungal sp. No.11243] Length = 101 Score = 127 bits (319), Expect = 3e-27 Identities = 59/84 (70%), Positives = 72/84 (85%) Frame = -2 Query: 260 MPGTDRKIFPEKVQDKQGNEKGGVLSFVGDPLGKGLETGLSPIGAGLGKVTGPVADGASQ 81 MPGTDRKI PEKVQ+ +G EK G+L+ +GDPLGK LETGLSPIGAG+GKVTGP A+GAS Sbjct: 1 MPGTDRKIVPEKVQNSKGEEKSGLLAPLGDPLGKALETGLSPIGAGVGKVTGPAAEGASN 60 Query: 80 VSKPVMDKLGMQDRGEAKEQKQFK 9 V+KP+MD LGM DRGE K++++ K Sbjct: 61 VTKPIMDSLGMGDRGEMKQREELK 84