BLASTX nr result
ID: Cornus23_contig00022487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022487 (508 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoe... 70 6e-10 ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoe... 62 2e-07 >ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] gi|440800957|gb|ELR21983.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] Length = 224 Score = 70.1 bits (170), Expect = 6e-10 Identities = 47/166 (28%), Positives = 85/166 (51%), Gaps = 2/166 (1%) Frame = +1 Query: 4 QPIWPKSFSASVAIHNWRRSSEPFH-LIRWFYDSELDADRIDTLATWLDEPYWAELIFDH 180 +P P +FSA+V + +R+ +P+ RWF D +L R+D LA E + I+DH Sbjct: 30 KPTLPPAFSAAVHV---QRNYKPYQEYFRWFRDEKLQKARVDRLAEVHGETLFHSFIYDH 86 Query: 181 KKGEETNVYYQGSLASCFRRKFNTTDHPLPHPDFSQFKFAGVAEINYEKVDHWYYHDEQR 360 + + V+++G +A+CF + T L H D S+ +F G + + ++ V HW E Sbjct: 87 SEQKMFAVFFRGEVATCFTK---TIRGNLTHFDLSEAEFLGKSYVYFDPVYHWQL--ETD 141 Query: 361 RESFQVYSRSDNGR-LVRIDRADLERRRAETFDFHEFDVATRSFTL 495 R F+++ + R L ++ +A ++ HEFD ++ +L Sbjct: 142 RYHFELFDTPEPHRELRKVSFFIKPNGKAGSWTMHEFDAGSQDESL 187 >ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] gi|440800189|gb|ELR21231.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] Length = 229 Score = 62.0 bits (149), Expect = 2e-07 Identities = 37/170 (21%), Positives = 77/170 (45%), Gaps = 6/170 (3%) Frame = +1 Query: 4 QPIWPKSFSASVAIHNWRRSSEPFH-LIRWFYDSELDADRIDTLATWLDEPYWAELIFDH 180 +P WP ++SA+V WR + P H R F+D + R+ + W + Y E ++ Sbjct: 30 KPQWPSTYSATV---EWRSNHHPHHKFFRMFWDEKNCRARVGGMVKWKGKHYKMEALYYG 86 Query: 181 KKGEETNVYYQGSLASCFRRKFNTTDHPLPHPDFSQFKFAGVAEINYEKVDHWYYH---- 348 KK ++Y+ CF + + + D S + G+A + Y V HW Sbjct: 87 KKNAAYYIFYERDQVKCF--TMDLKNKTIKGLDLSDADYKGMALVEYHPVYHWEKDIETK 144 Query: 349 -DEQRRESFQVYSRSDNGRLVRIDRADLERRRAETFDFHEFDVATRSFTL 495 D++++ +V+ ++ + ++D + + + + FHE + ++ +L Sbjct: 145 GDDKKKAHIRVFDTQEDREIKKLDYSMHDENKIGSMLFHEVNYGPQADSL 194