BLASTX nr result
ID: Cornus23_contig00022213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022213 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69962.1| hypothetical protein VITISV_008740 [Vitis vinifera] 57 7e-06 >emb|CAN69962.1| hypothetical protein VITISV_008740 [Vitis vinifera] Length = 809 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 7 DVVWVLDCSIKRFETRFLTKYKEVAPEVIKAYEGEIGFQGFNTRL 141 DVVW+L+ K FET+FL +K+ APEVIKAY+ +G QGFN L Sbjct: 757 DVVWILNLDKKTFETKFLIPFKDDAPEVIKAYQEGMGLQGFNDGL 801