BLASTX nr result
ID: Cornus23_contig00022177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00022177 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011037856.1| PREDICTED: hydroquinone glucosyltransferase-... 57 5e-06 >ref|XP_011037856.1| PREDICTED: hydroquinone glucosyltransferase-like [Populus euphratica] Length = 511 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 320 GNLIRNRMKYLQNTARNVLNEDGWSTKSLSELVSKWRNHKC 198 G +RNRMK L++ A VL+EDG STK+LSE+ KW+NHKC Sbjct: 466 GKRVRNRMKDLKDAAAEVLSEDGSSTKALSEVARKWKNHKC 506