BLASTX nr result
ID: Cornus23_contig00021639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00021639 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083138.1| PREDICTED: zinc finger CCCH domain-containin... 81 3e-13 ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containin... 80 6e-13 emb|CBI30026.3| unnamed protein product [Vitis vinifera] 80 6e-13 gb|KRH71868.1| hypothetical protein GLYMA_02G173900 [Glycine max] 79 1e-12 gb|KRH71867.1| hypothetical protein GLYMA_02G173900 [Glycine max] 79 1e-12 ref|XP_011078827.1| PREDICTED: zinc finger CCCH domain-containin... 79 1e-12 gb|KHN25499.1| Zinc finger CCCH domain-containing protein 44 [Gl... 79 1e-12 ref|XP_007145681.1| hypothetical protein PHAVU_007G259300g [Phas... 79 1e-12 gb|KHN37267.1| Zinc finger CCCH domain-containing protein 14 [Gl... 79 2e-12 ref|XP_009614706.1| PREDICTED: zinc finger CCCH domain-containin... 79 2e-12 emb|CDP10133.1| unnamed protein product [Coffea canephora] 79 2e-12 ref|XP_003536809.1| PREDICTED: zinc finger CCCH domain-containin... 79 2e-12 ref|NP_001242091.1| uncharacterized protein LOC100817463 [Glycin... 79 2e-12 ref|XP_011075147.1| PREDICTED: zinc finger CCCH domain-containin... 78 2e-12 ref|XP_002533458.1| conserved hypothetical protein [Ricinus comm... 78 2e-12 ref|XP_002533457.1| conserved hypothetical protein [Ricinus comm... 78 2e-12 ref|XP_014514209.1| PREDICTED: zinc finger CCCH domain-containin... 78 3e-12 gb|KOM36602.1| hypothetical protein LR48_Vigan02g275200 [Vigna a... 78 3e-12 gb|KHN27134.1| Zinc finger CCCH domain-containing protein 14 [Gl... 78 3e-12 ref|XP_008367363.1| PREDICTED: zinc finger CCCH domain-containin... 78 3e-12 >ref|XP_011083138.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Sesamum indicum] Length = 299 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 APA+NYKTKLCENF KGSCTFGERCHFAHGA ELRKSG+ Sbjct: 261 APANNYKTKLCENFTKGSCTFGERCHFAHGAEELRKSGI 299 >ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containing protein 14 [Vitis vinifera] Length = 297 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 PASNYKTKLC+NF KGSCTFGERCHFAHGAGELRKS + Sbjct: 260 PASNYKTKLCDNFTKGSCTFGERCHFAHGAGELRKSAI 297 >emb|CBI30026.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 PASNYKTKLC+NF KGSCTFGERCHFAHGAGELRKS + Sbjct: 202 PASNYKTKLCDNFTKGSCTFGERCHFAHGAGELRKSAI 239 >gb|KRH71868.1| hypothetical protein GLYMA_02G173900 [Glycine max] Length = 227 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFGERCHFAHGA ELRKSGV Sbjct: 190 PGSNFKTKLCENFAKGSCTFGERCHFAHGAAELRKSGV 227 >gb|KRH71867.1| hypothetical protein GLYMA_02G173900 [Glycine max] Length = 295 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFGERCHFAHGA ELRKSGV Sbjct: 258 PGSNFKTKLCENFAKGSCTFGERCHFAHGAAELRKSGV 295 >ref|XP_011078827.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Sesamum indicum] Length = 292 Score = 79.3 bits (194), Expect = 1e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 AP SN+KTKLCENF KGSCTFG+RCHFAHGA ELRKSG+ Sbjct: 254 APGSNFKTKLCENFSKGSCTFGDRCHFAHGAAELRKSGI 292 >gb|KHN25499.1| Zinc finger CCCH domain-containing protein 44 [Glycine soja] Length = 227 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFGERCHFAHGA ELRKSGV Sbjct: 190 PGSNFKTKLCENFAKGSCTFGERCHFAHGAAELRKSGV 227 >ref|XP_007145681.1| hypothetical protein PHAVU_007G259300g [Phaseolus vulgaris] gi|561018871|gb|ESW17675.1| hypothetical protein PHAVU_007G259300g [Phaseolus vulgaris] Length = 293 Score = 79.0 bits (193), Expect = 1e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFG+RCHFAHGAGELRK GV Sbjct: 256 PGSNFKTKLCENFAKGSCTFGDRCHFAHGAGELRKQGV 293 >gb|KHN37267.1| Zinc finger CCCH domain-containing protein 14 [Glycine soja] Length = 297 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 APASN+KTKLCENF KGSCTFGERCHFAHG ELRKSG+ Sbjct: 259 APASNFKTKLCENFAKGSCTFGERCHFAHGNDELRKSGM 297 >ref|XP_009614706.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Nicotiana tomentosiformis] Length = 294 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SNYKTKLCENF KGSCTFGERCHFAHGA ELRK+GV Sbjct: 257 PMSNYKTKLCENFAKGSCTFGERCHFAHGATELRKTGV 294 >emb|CDP10133.1| unnamed protein product [Coffea canephora] Length = 291 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SNYKTKLCENF KGSCTF ERCHFAHGA ELRKSGV Sbjct: 254 PGSNYKTKLCENFAKGSCTFAERCHFAHGAAELRKSGV 291 >ref|XP_003536809.1| PREDICTED: zinc finger CCCH domain-containing protein 14 [Glycine max] gi|947087609|gb|KRH36330.1| hypothetical protein GLYMA_10G296700 [Glycine max] Length = 297 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 APASN+KTKLCENF KGSCTFGERCHFAHG ELRKSG+ Sbjct: 259 APASNFKTKLCENFAKGSCTFGERCHFAHGNDELRKSGM 297 >ref|NP_001242091.1| uncharacterized protein LOC100817463 [Glycine max] gi|255636598|gb|ACU18637.1| unknown [Glycine max] Length = 295 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFGERCHFAHGA ELRKSGV Sbjct: 258 PGSNFKTKLCENFPKGSCTFGERCHFAHGAAELRKSGV 295 >ref|XP_011075147.1| PREDICTED: zinc finger CCCH domain-containing protein 36 [Sesamum indicum] Length = 240 Score = 78.2 bits (191), Expect = 2e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 AP SN+KTKLCENF KGSCTFG+RCHFAHGA ELRK+G+ Sbjct: 202 APGSNFKTKLCENFSKGSCTFGDRCHFAHGAAELRKTGI 240 >ref|XP_002533458.1| conserved hypothetical protein [Ricinus communis] gi|223526691|gb|EEF28927.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFG+RCHFAHGA ELRKSGV Sbjct: 258 PGSNFKTKLCENFSKGSCTFGQRCHFAHGAAELRKSGV 295 >ref|XP_002533457.1| conserved hypothetical protein [Ricinus communis] gi|223526690|gb|EEF28926.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SN+KTKLCENF KGSCTFG+RCHFAHGA ELRKSGV Sbjct: 258 PGSNFKTKLCENFSKGSCTFGQRCHFAHGAAELRKSGV 295 >ref|XP_014514209.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Vigna radiata var. radiata] Length = 333 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 APASN+KTKLCENF KGSCTFGERCHFAHG +LRK+G+ Sbjct: 295 APASNFKTKLCENFAKGSCTFGERCHFAHGTDDLRKTGI 333 >gb|KOM36602.1| hypothetical protein LR48_Vigan02g275200 [Vigna angularis] Length = 298 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 APASN+KTKLCENF KGSCTFGERCHFAHG +LRK+G+ Sbjct: 260 APASNFKTKLCENFAKGSCTFGERCHFAHGTDDLRKTGI 298 >gb|KHN27134.1| Zinc finger CCCH domain-containing protein 14 [Glycine soja] Length = 298 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 286 APASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 AP SN+KTKLCENF KGSCTFGERCHFAHG ELRKSG+ Sbjct: 260 APTSNFKTKLCENFAKGSCTFGERCHFAHGTDELRKSGM 298 >ref|XP_008367363.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Malus domestica] Length = 298 Score = 77.8 bits (190), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 283 PASNYKTKLCENFGKGSCTFGERCHFAHGAGELRKSGV 170 P SNYKTKLC+NF KG+CTFGERCHFAHGA ELRKSGV Sbjct: 261 PGSNYKTKLCDNFTKGTCTFGERCHFAHGAAELRKSGV 298