BLASTX nr result
ID: Cornus23_contig00021483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00021483 (466 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ61643.1| hypothetical protein BGT96224_A20579 [Blumeria gr... 62 2e-07 >gb|EPQ61643.1| hypothetical protein BGT96224_A20579 [Blumeria graminis f. sp. tritici 96224] Length = 348 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = -3 Query: 152 DQAYWLRVIQSPMLRDEERLLVRLKGLQDYPWKIIQSKFNNRYGKKMRQ 6 D++YW +++SP L +EERLLVRLKG++ PWK IQ+KFN + G + Q Sbjct: 155 DRSYWQNLVKSPHLTEEERLLVRLKGIEGLPWKDIQAKFNEKMGTYVEQ 203