BLASTX nr result
ID: Cornus23_contig00021027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00021027 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFY29182.1| hypothetical protein V493_02505 [Pseudogymnoascus... 60 6e-07 gb|KFY75972.1| hypothetical protein V498_09810 [Pseudogymnoascus... 57 5e-06 gb|KFY59705.1| hypothetical protein V496_05571 [Pseudogymnoascus... 57 5e-06 >gb|KFY29182.1| hypothetical protein V493_02505 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 639 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 295 ESNTYNDLAFKQRVFNDPTVLKLQDLGNWKGGA 197 ES+TYNDLAFK++V+ DPTVLKL+DLGNWKG A Sbjct: 572 ESDTYNDLAFKKKVYGDPTVLKLKDLGNWKGVA 604 >gb|KFY75972.1| hypothetical protein V498_09810 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 652 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 292 SNTYNDLAFKQRVFNDPTVLKLQDLGNWKG 203 S+TYNDLAFK++V+ DPTVLKL+DLGNWKG Sbjct: 586 SDTYNDLAFKKKVYADPTVLKLKDLGNWKG 615 >gb|KFY59705.1| hypothetical protein V496_05571 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] Length = 652 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 292 SNTYNDLAFKQRVFNDPTVLKLQDLGNWKG 203 S+TYNDLAFK++V+ DPTVLKL+DLGNWKG Sbjct: 586 SDTYNDLAFKKKVYADPTVLKLKDLGNWKG 615