BLASTX nr result
ID: Cornus23_contig00021015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00021015 (641 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW89353.1| hypothetical protein EUGRSUZ_A01649, partial [Euc... 59 2e-06 >gb|KCW89353.1| hypothetical protein EUGRSUZ_A01649, partial [Eucalyptus grandis] Length = 192 Score = 59.3 bits (142), Expect = 2e-06 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = -2 Query: 433 ARMHLQERSRSCAA--KDMSWRASSEKPIPKIH*SLLLCLSQNPYSNYALSVMK 278 A H+++ SR A KD+ WRASS KPIPKIH + +L +SQ PYS YA+SVMK Sbjct: 63 AHSHIRKMSRKGAPLPKDVPWRASSGKPIPKIHHNPVLRVSQTPYSTYAISVMK 116