BLASTX nr result
ID: Cornus23_contig00020744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00020744 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU77317.1| GDSL-like Lipase [Blumeria graminis f. sp. horde... 73 1e-10 gb|EPQ61534.1| hypothetical protein BGT96224_3642 [Blumeria gram... 73 1e-10 >emb|CCU77317.1| GDSL-like Lipase [Blumeria graminis f. sp. hordei DH14] Length = 253 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -2 Query: 138 LPHLRILPLGDSITYGFLSTTGNGYRASLYNLLNVTFPSVSFIGSQ 1 LP+LRILPLGDSITYG+ ST+G+GYRA+L+ LN TFPSV +IG+Q Sbjct: 11 LPNLRILPLGDSITYGYRSTSGDGYRAALFGSLNSTFPSVKYIGTQ 56 >gb|EPQ61534.1| hypothetical protein BGT96224_3642 [Blumeria graminis f. sp. tritici 96224] Length = 312 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -2 Query: 138 LPHLRILPLGDSITYGFLSTTGNGYRASLYNLLNVTFPSVSFIGSQ 1 LP+LRILPLGDSITYG+ ST+G+GYRA+L+ LN TFPSV +IG+Q Sbjct: 70 LPNLRILPLGDSITYGYRSTSGDGYRAALFGSLNSTFPSVKYIGTQ 115